Recombinant Pongo pygmaeus Taste receptor type 2 member 10 (TAS2R10)

Shipped with Ice Packs
In Stock

Description

Biological Functions

TAS2R10 is part of the bitter taste receptor family (TAS2Rs) but exhibits diverse extracellular roles:

Molecular Pathways

  • Cell Cycle Regulation: Associated with cellular processes like ubiquitin-mediated proteolysis and retrograde endocannabinoid signaling .

  • Pathogen Response: Linked to Salmonella infection pathways, suggesting immune-related functions .

  • Glycosylation Potential: While not experimentally confirmed, GlyCosmos data lists TAS2R10 under Pongo pygmaeus with 2 glycosites (N-linked), though no glycan structures are validated .

Physiological Implications

  • Skin Aging: TAS2R10 inhibits cellular senescence and epithelial-mesenchymal transition (EMT) in human keratinocytes, potentially mitigating skin aging .

  • Cancer Stem Cells (CSCs): Overexpression suppresses cancer stemness and invasion in neuroblastoma models, though mechanisms remain under investigation .

Research Applications

TAS2R10 is utilized in functional studies to elucidate bitter perception and disease pathways:

Cancer Research

  • Experimental Design: TAS2R10 is cloned into FLAG-tagged pcDNA3 vectors using E. coli (e.g., dh5-α) for transfection into human cell lines .

  • Key Findings:

    • Suppresses CSC self-renewal and invasion in neuroblastoma (NB) cells.

    • Synergizes with TAS2R8 to enhance anti-tumor effects .

Skin Aging Models

  • HaCaT Keratinocytes: TAS2R10 upregulates antioxidant enzymes (e.g., SOD, CAT) and modulates the SIRT1/mTOR pathway to counteract D-galactose-induced senescence .

Key Challenges and Gaps

  • Structural Complexity: Full-length recombinant TAS2R10 remains challenging to produce due to its transmembrane topology .

  • Functional Specificity: Distinction from human TAS2R10 is critical, as species-specific ligand binding may differ .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R10; Taste receptor type 2 member 10; T2R10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Pongo pygmaeus (Bornean orangutan)
Target Names
Target Protein Sequence
MLSVVEGIFIFVVISESVFGVLGNGFIGLVNCIDCAKNKLSTIGFILTGLAISRIFLIWV IITDGFIQIFSPDIYASGNLIEYISYIWVIGNQSSMWFATSLSIFYFLKIANFSNYIFLW LKSRTNMVLPFMMAFLLISSLLNFAHIVKILNDHKMKNDTVWHLNMYKSEYFIKQILLNL GVIFFFTLSLITCVLLIISLWRHNRQMQSNVTGLRDSNTEAHVKAMKVLISFIILFILYF IGMALEISRFTVPENKLLLMFGMTTTAIYPWGHSFILILGNSKLKQASLRVLQQLKCCEK RKKSQSHI
Uniprot No.

Target Background

Function
This receptor may play a role in perceiving bitterness and is linked to gustducin. It could be involved in sensing the chemical composition of the gastrointestinal contents. Activation of this receptor may stimulate alpha gustducin, mediating PLC-beta-2 activation and potentially leading to the gating of TRPM5.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How is recombinant Pongo pygmaeus TAS2R10 typically expressed and purified for research applications?

Recombinant Pongo pygmaeus TAS2R10 is typically expressed in E. coli expression systems with an N-terminal histidine tag to facilitate purification. According to available product information, the full-length protein (amino acids 1-308) is expressed using bacterial systems and supplied as a lyophilized powder . The general methodology involves:

  • Cloning the TAS2R10 gene into an appropriate expression vector with an N-terminal His-tag

  • Transformation into E. coli expression hosts

  • Induction of protein expression

  • Cell lysis and protein extraction

  • Affinity chromatography using the His-tag

  • Lyophilization for storage

For reconstitution and working with the protein, researchers should:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol (5-50%, with 50% being standard) for long-term storage

  • Aliquot and store at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

What are the key structural features of TAS2R10 and how do they relate to its function?

TAS2R10, like other bitter taste receptors, is a G-protein-coupled receptor with a characteristic seven-transmembrane domain structure. Based on computational modeling studies of human TAS2R10, key structural features include:

  • Seven transmembrane helices forming a central cavity

  • An extracellular N-terminus and intracellular C-terminus

  • A putative binding pocket located between the upper parts of transmembrane domains III to VII

  • Specific residues whose side chains point into the central cavity that are critical for agonist recognition

These structural features enable TAS2R10 to recognize diverse bitter compounds. The binding pocket accommodates various chemical structures, explaining the broad tuning observed in some bitter taste receptors. Upon ligand binding, conformational changes in the receptor trigger G-protein activation and downstream signaling cascades, ultimately leading to bitter taste perception .

How does Pongo pygmaeus TAS2R10 compare to its human ortholog?

While the search results don't provide a direct comparison between orangutan and human TAS2R10, we can infer relationships based on available information:

FeaturePongo pygmaeus TAS2R10Human TAS2R10
Length308 amino acids Similar length (exact not specified in sources)
FunctionBitter taste perceptionResponds to strychnine and numerous other bitter compounds
Binding pocketPresumed to be between TM domains III-VIILocated between upper parts of TM domains III-VII
Evolutionary relationshipOrthologous to human TAS2R10Exhibits 34% amino acid identity with human TAS2R46

What methodological approaches are optimal for conducting functional assays with recombinant TAS2R10?

Functional characterization of recombinant TAS2R10 requires carefully designed assays that account for the challenges associated with G-protein-coupled receptor research. Based on methodologies used for human bitter taste receptors, the following approaches are recommended:

  • Expression System Selection:

    • Heterologous mammalian cell lines (typically HEK293T) for functional studies

    • Co-expression with appropriate G-proteins (typically Gα16 or chimeric G-proteins)

    • Addition of trafficking enhancers if needed for cell surface expression

  • Calcium Imaging Assays:

    • Transfection of cells with TAS2R10 and calcium-sensitive fluorescent dyes or genetically encoded calcium indicators

    • Application of putative bitter ligands at varying concentrations

    • Real-time monitoring of intracellular calcium release

    • Analysis of dose-response relationships

  • Controls and Validation:

    • Empty vector transfections as negative controls

    • Known bitter taste receptor agonists as positive controls

    • Antagonist studies to confirm specificity

    • Multiple biological replicates to ensure reproducibility

  • Agonist Selection:

    • Test compounds known to activate human TAS2R10 (strychnine, parthenolide, denatonium benzoate)

    • Plant-derived bitter compounds relevant to orangutan diet

    • Panels of structurally diverse bitter compounds to establish receptor tuning properties

These methodologies should be optimized for the specific properties of Pongo pygmaeus TAS2R10, considering potential differences in ligand sensitivity and G-protein coupling efficiency compared to human receptors.

How can site-directed mutagenesis be effectively employed to identify critical residues in TAS2R10 function?

Site-directed mutagenesis represents a powerful approach for identifying amino acid residues critical for TAS2R10 function. Based on established protocols for human bitter taste receptors , a comprehensive mutagenesis strategy should include:

  • Receptor Modeling and Target Selection:

    • Generate a 3D homology model based on crystal structures of related GPCRs (e.g., β2 adrenergic receptor)

    • Identify residues whose side chains project into the putative binding pocket

    • Select conserved residues across TAS2R family members

    • Target residues in transmembrane domains III-VII that likely form the binding pocket

  • Mutagenesis Approach:

    • Systematic alanine-scanning mutagenesis of selected residues

    • Targeted substitutions based on evolutionary analysis

    • Conservative and non-conservative substitutions to probe specific interactions

  • Functional Characterization:

    • Express wild-type and mutant receptors in heterologous systems

    • Compare dose-response relationships for various agonists

    • Classify mutations based on effects:

      • Loss of function (reduced response to all agonists)

      • Altered specificity (differential effects on different agonists)

      • Enhanced function (increased sensitivity to agonists)

  • Data Analysis and Interpretation:

    • Map mutations onto the 3D receptor model

    • Identify patterns in residue positions and effects

    • Compare with known functional residues in other TAS2Rs

    • Use data to refine binding pocket models

This systematic approach has successfully identified key residues in human TAS2R10, including residues in transmembrane domain VII that are particularly important for agonist selectivity .

What evolutionary patterns are observed in TAS2R10 across primate species and what do they reveal about functional adaptation?

Evolutionary analysis of TAS2R genes provides insights into their functional adaptation across primate lineages. While the search results don't specifically detail TAS2R10 evolution, general patterns in the TAS2R family include:

  • Phylogenetic Distribution:

    • Some TAS2R genes exist as one-to-one orthologs across primate species

    • Others show lineage-specific duplications or losses

    • TAS2Rs cluster into distinct clades with specific evolutionary patterns

  • Selective Pressures:

    • Variable selection pressures across different primate lineages

    • Adaptive evolution in response to dietary specialization

    • Some TAS2R genes show relaxation of selective constraints in certain lineages

  • Gene Dynamics:

    • Substantial variation in gene gain and loss events across lineages

    • Some lineages (e.g., some Strepsirrhini) show significant gene loss events (≥5 genes)

    • Others show gene expansion events

  • Functional Implications:

    • Evolutionary patterns likely reflect adaptation to different dietary niches

    • Additional factors influencing TAS2R evolution include:

      • Cognitive abilities enabling food recognition without tasting

      • Social transmission of food information

      • Self-medication behaviors

To specifically understand TAS2R10 evolution, comparative genomic analysis across primate species would be needed to determine if it follows patterns of one-to-one orthology or shows evidence of duplication/loss in certain lineages, providing insights into its functional importance across different ecological niches.

How does genetic diversity in TAS2R10 relate to functional diversity, and what methodologies best capture this relationship?

Understanding the relationship between genetic and functional diversity in TAS2R10 requires integrating multiple analytical approaches. Studies of human TAS2R genes provide a methodological framework:

  • Genetic Diversity Analysis:

    • Sequencing TAS2R10 across individuals and populations

    • Identifying SNPs, indels, and structural variants

    • Calculating diversity metrics:

      • Per nucleotide heterozygosity (π)

      • Population differentiation (FST)

      • Tests for natural selection (Tajima's D)

  • Computational Prediction of Functional Effects:

    • Utilizing algorithms like PolyPhen-2 and SIFT to predict functional impacts of nonsynonymous variants

    • Analysis of variants affecting start/stop codons and frameshift mutations

    • Structural mapping of variants onto 3D receptor models

  • Functional Validation:

    • In vitro expression of variant receptors

    • Dose-response analysis with multiple ligands

    • Comparison of receptor activation profiles

    • Cell surface expression analysis

  • Integration and Interpretation:

    • Correlation between genetic variants and functional parameters

    • Population-specific patterns and their ecological context

    • Evolutionary history of functional variants

How can computational modeling be optimally applied to predict agonist binding sites in TAS2R10?

Computational modeling offers powerful approaches for predicting agonist binding sites in TAS2R10. Based on successful methodologies applied to human TAS2R10 , a comprehensive modeling strategy should include:

  • Homology Model Generation:

    • Selection of appropriate structural templates (e.g., β2 adrenergic receptor-Gs-protein complex)

    • Sequence alignment optimization using specialized servers (e.g., Expresso) and manual refinement

    • Model building using programs like Modeler

    • Iterative refinement through:

      • Energy minimization with CHARMM force field

      • Side-chain optimization with SCWRL4

      • Additional rounds of energy minimization

  • Binding Site Identification:

    • Energy-based methods to identify favorable binding regions

    • Focusing on the central cavity formed by transmembrane domains

    • Particular attention to the region between upper parts of TMs III-VII

    • Analysis of pocket volume, hydrophobicity, and electrostatic properties

  • Agonist Docking:

    • Preparation of ligand libraries including known bitter compounds

    • Molecular docking using flexible docking algorithms

    • Evaluation of binding poses and interaction energies

    • Clustering analysis of docking results

  • Validation and Refinement:

    • Comparison with mutagenesis data

    • Molecular dynamics simulations to assess stability of binding modes

    • Refinement based on experimental feedback

    • Prediction of novel interactions for experimental testing

This integrated computational approach has successfully identified the binding modes of strychnine, parthenolide, and denatonium benzoate in human TAS2R10 , providing a template for similar analyses of the orangutan ortholog.

What is the emerging evidence for non-gustatory roles of TAS2R10, and how can these functions be experimentally investigated?

While the search results don't specifically address non-gustatory roles of Pongo pygmaeus TAS2R10, emerging evidence suggests taste receptors may have functions beyond taste perception:

  • Immune Surveillance:

    • Taste cells show gene expression signatures resembling Microfold (M) cells, key players in immune surveillance

    • Taste cells may tune their responses to microbial signaling and infection

    • Sweet and umami receptor cells expressing Tas1r3 particularly show immune-related expression profiles

  • Research Approaches for TAS2R10:

    • Expression Analysis:

      • RT-PCR and immunohistochemistry to detect TAS2R10 in non-gustatory tissues

      • Single-cell RNA sequencing to identify cell types expressing TAS2R10

      • Comparative analysis across species

    • Functional Studies:

      • Exposure of TAS2R10-expressing cells to microbial compounds

      • Analysis of immune signaling pathway activation

      • Gene knockout/knockdown studies in model systems

      • Ex vivo tissue studies

    • Ecological and Evolutionary Context:

      • Comparison of expression patterns across primate species

      • Correlation with ecological factors (diet, habitat, pathogen exposure)

      • Analysis of selection signatures in non-gustatory versus gustatory contexts

  • Potential Applications:

    • Understanding the role of taste receptors in mucosal immunity

    • Identifying novel antimicrobial compounds targeting TAS2R10

    • Developing interventions for taste disorders associated with infection

Investigation of these non-gustatory functions could provide novel insights into the multifaceted roles of taste receptors in organismal physiology and evolution.

What techniques can researchers employ to improve stability and yield of recombinant TAS2R10 for structural studies?

Membrane proteins like TAS2R10 present significant challenges for structural studies due to their hydrophobicity and conformational flexibility. Strategies to improve stability and yield include:

  • Expression System Optimization:

    • E. coli-based approaches:

      • Use of specialized strains (C41/C43, Rosetta)

      • Fusion partners (MBP, SUMO, Mistic) to improve folding

      • Low-temperature induction protocols

      • Optimization of media and induction conditions

    • Alternative expression systems:

      • Insect cells (baculovirus expression)

      • Mammalian cells for native-like folding

      • Cell-free expression systems

  • Protein Engineering:

    • Thermostabilizing mutations

    • Removal of flexible regions

    • Addition of stabilizing disulfide bonds

    • Creation of receptor chimeras with stable GPCRs

    • Nanobody or antibody co-expression for conformational stabilization

  • Purification and Stabilization:

    • Optimized detergent selection

    • Lipid/nanodisc reconstitution

    • Amphipol stabilization

    • Addition of stabilizing ligands during purification

    • Glycerol and other additives in storage buffers

  • Quality Control:

    • Size exclusion chromatography to assess monodispersity

    • Thermal stability assays

    • Ligand binding assays to confirm functionality

    • Circular dichroism to assess secondary structure

For recombinant Pongo pygmaeus TAS2R10 specifically, storage recommendations include reconstitution in deionized sterile water (0.1-1.0 mg/mL), addition of glycerol (5-50%), aliquoting for storage at -20°C/-80°C, and avoiding repeated freeze-thaw cycles .

How can researchers effectively validate the functionality of recombinant Pongo pygmaeus TAS2R10?

Validating the functionality of recombinant TAS2R10 requires a multi-faceted approach to ensure the protein maintains its native activity. Recommended methodologies include:

  • Structural Integrity Assessment:

    • SDS-PAGE to confirm protein size and purity (>90% purity is typically desired)

    • Western blotting with anti-His antibodies to verify tag presence

    • Circular dichroism to assess secondary structure elements characteristic of GPCRs

    • Thermal shift assays to evaluate protein stability

  • Ligand Binding Assays:

    • Radioligand binding with tritiated bitter compounds

    • Fluorescence-based binding assays

    • Surface plasmon resonance to determine binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

  • Functional Response Assays:

    • Calcium mobilization assays in heterologous expression systems

    • Bioluminescence resonance energy transfer (BRET) to measure G-protein coupling

    • GTPγS binding assays to measure G-protein activation

    • Comparison with known human TAS2R10 responses to strychnine, parthenolide, and denatonium benzoate

  • Controls and Benchmarking:

    • Positive controls with well-characterized bitter taste receptors

    • Negative controls with non-functional receptor mutants

    • Dose-response curves to establish EC50 values

    • Specificity testing with compounds that don't activate human TAS2R10

These validation steps ensure that functional studies yield reliable and reproducible results, particularly important given the challenges associated with expressing and studying membrane proteins like TAS2R10.

What approaches can be used to study the potential role of TAS2R10 in mucosal immune surveillance?

Investigation of TAS2R10's potential role in mucosal immune surveillance requires integrating molecular, cellular, and physiological approaches:

  • Expression Profiling:

    • Single-cell RNA sequencing of oral and gut tissues to identify cell types expressing TAS2R10

    • Comparative transcriptomics between gustatory and non-gustatory tissues

    • Immunohistochemistry to localize TAS2R10 protein in mucosal tissues

    • Analysis of co-expression with immune markers

  • Functional Analysis:

    • Exposure of TAS2R10-expressing cells to microbial components

    • Assessment of immune signaling pathway activation

    • Cytokine/chemokine profiling following receptor activation

    • Ex vivo tissue explant studies with receptor agonists and antagonists

  • Microbiome Interactions:

    • Screening microbial metabolites for TAS2R10 activation

    • Co-culture systems with commensal and pathogenic microbes

    • Analysis of receptor regulation during infection or dysbiosis

    • Comparative studies across primate species with different microbiomes

  • In Vivo Studies:

    • Development of TAS2R10 reporter systems in model organisms

    • Conditional knockout approaches in specific tissues

    • Challenge studies with pathogens or microbial compounds

    • Analysis of immune responses in the presence of TAS2R10 modulators

These approaches would build upon the observation that taste cells participate in mucosal immune surveillance and may tune their responses to microbial signaling and infection , potentially revealing novel functions for TAS2R10 beyond bitter taste perception.

How can evolutionary genomics approaches be applied to understand TAS2R10 adaptation across primate species?

Evolutionary genomics offers powerful tools for understanding TAS2R10 adaptation across primates:

  • Comparative Sequence Analysis:

    • Whole genome sequencing and targeted resequencing of TAS2R10 across primate species

    • Multiple sequence alignment and phylogenetic reconstruction

    • Identification of conserved domains and variable regions

    • Classification within the broader context of TAS2R evolution

  • Selection Analysis:

    • Calculation of dN/dS ratios to detect selective pressure

    • Site-specific and branch-specific selection tests

    • Identification of episodic selection events

    • Analysis of selection patterns in binding pocket versus structural regions

  • Gene Dynamics Analysis:

    • Assessment of gene duplication, loss, and pseudogenization events

    • Synteny analysis to identify chromosomal rearrangements

    • Dating of duplication/loss events using molecular clock approaches

    • Correlation with primate divergence events and dietary shifts

  • Structure-Function Correlation:

    • Mapping evolutionary changes onto structural models

    • Prediction of functional effects of species-specific substitutions

    • Experimental validation of predicted functional differences

    • Ecological correlation with dietary bitter compound exposure

These approaches would provide insights into how TAS2R10 has adapted to different ecological niches across primate evolution, potentially revealing patterns of convergent or divergent evolution related to diet and other environmental factors .

What methodologies are most effective for identifying novel ligands for Pongo pygmaeus TAS2R10?

Identifying novel ligands for Pongo pygmaeus TAS2R10 requires a multi-disciplinary approach:

  • Computational Screening:

    • Pharmacophore modeling based on known bitter compounds

    • Virtual screening of chemical libraries

    • Molecular docking to homology models

    • Machine learning approaches trained on known bitter compounds

    • Analysis of chemical features shared with human TAS2R10 ligands

  • High-throughput Screening:

    • Calcium imaging assays with TAS2R10-expressing cell lines

    • FLIPR (Fluorometric Imaging Plate Reader) for parallel screening

    • Bioluminescence-based reporter systems

    • Testing of:

      • Plant extracts from orangutan diet

      • Known bitter compounds from different chemical classes

      • Microbial metabolites

  • Structure-Activity Relationship Studies:

    • Systematic modification of known TAS2R10 agonists

    • Analysis of minimal structural requirements for activation

    • Identification of pharmacophore features

    • Development of more potent or selective ligands

  • Validation and Characterization:

    • Dose-response analysis for hit compounds

    • Selectivity testing against other TAS2Rs

    • Antagonist screening to identify blockers

    • Comparative analysis with human TAS2R10 responses

This integrated approach would establish the ligand profile of Pongo pygmaeus TAS2R10, providing insights into its physiological role and evolutionary adaptation to the orangutan diet.

What are the major technical challenges in working with recombinant bitter taste receptors like TAS2R10?

Working with bitter taste receptors presents several technical challenges that researchers must address:

  • Expression and Purification Challenges:

    • Low expression levels in heterologous systems

    • Improper folding and aggregation

    • Maintaining stability during purification

    • Limited yield of functional protein

  • Structural Characterization Barriers:

    • Difficulty in obtaining crystals for X-ray crystallography

    • Size limitations for NMR studies

    • Conformational heterogeneity

    • Dependence on lipid environment for native conformation

  • Functional Assay Limitations:

    • Background signaling in heterologous systems

    • Variability in G-protein coupling efficiency

    • Need for specialized equipment for real-time monitoring

    • Potential non-specific effects of bitter compounds

  • Biological Relevance Concerns:

    • Extrapolation from in vitro to in vivo significance

    • Species differences in receptor pharmacology

    • Complex interactions with taste signaling components

    • Contextual effects of the cell or tissue environment

  • Theoretical and Computational Challenges:

    • Limited homology with receptors of known structure

    • Uncertainty in transmembrane domain boundaries

    • Difficulty in modeling flexible regions

    • Accurately predicting protein-ligand interactions

Addressing these challenges requires interdisciplinary approaches combining molecular biology, biochemistry, pharmacology, and computational modeling.

How might recent advances in computational biology enhance our understanding of TAS2R10 structure and function?

Recent computational biology advances offer unprecedented opportunities to enhance our understanding of TAS2R10:

  • AI-Driven Structure Prediction:

    • AlphaFold and RoseTTAFold can predict protein structures with high accuracy

    • These approaches could overcome limitations of traditional homology modeling

    • Multiple conformational states could be predicted

    • Integration with experimental data for validation and refinement

  • Advanced Molecular Dynamics:

    • Long-timescale simulations to capture conformational dynamics

    • Enhanced sampling techniques to observe rare events

    • Coarse-grained approaches for system-scale modeling

    • Free energy calculations for ligand binding energetics

  • Machine Learning Applications:

    • Prediction of ligand binding affinities

    • Classification of functional variants

    • Identification of allosteric sites and modulators

    • Analysis of evolutionary patterns across large datasets

  • Integrative Modeling:

    • Combining multiple data sources (sequence, structure, functional data)

    • Network analysis of taste receptor interactions

    • Systems biology approaches to model signaling pathways

    • Evolutionary modeling to reconstruct ancestral sequences and functions

  • Novel Docking and Virtual Screening:

    • Physics-based scoring functions

    • Quantum mechanical calculations for interaction energies

    • Consensus scoring approaches

    • Fragment-based virtual screening

These computational advances, when integrated with experimental validation, promise to accelerate our understanding of TAS2R10 structure-function relationships and evolutionary adaptations.

What are the potential applications of TAS2R10 research beyond basic taste perception studies?

TAS2R10 research has implications extending far beyond basic taste perception:

  • Drug Discovery and Development:

    • Identifying bitter taste masking agents for pharmaceuticals

    • Developing selective TAS2R10 modulators as research tools

    • Understanding off-target effects of drugs that activate bitter taste receptors

    • Using TAS2R10 as a model system for GPCR-targeted drug design

  • Immune Function Studies:

    • Exploring TAS2R10's role in innate immunity

    • Investigating potential antimicrobial applications

    • Understanding taste alterations during infection

    • Developing immunomodulatory approaches targeting taste receptors

  • Evolutionary Biology:

    • Reconstructing dietary adaptations across primate lineages

    • Understanding sensory ecology of orangutans

    • Investigating co-evolution with plant defensive compounds

    • Comparative genomics to reveal selective pressures

  • Agricultural and Food Science:

    • Developing compounds to reduce bitterness in foods

    • Understanding species-specific taste preferences

    • Improving palatability of livestock feed

    • Engineering plants with modified bitter compound profiles

  • Conservation Biology:

    • Understanding feeding ecology of endangered orangutans

    • Predicting adaptability to changing food sources

    • Informing habitat conservation efforts

    • Comparative studies across great ape species

This broad range of applications highlights the interdisciplinary significance of TAS2R10 research and its potential to inform diverse fields from molecular pharmacology to conservation biology.

What are the key considerations for designing comprehensive research programs focused on Pongo pygmaeus TAS2R10?

Designing comprehensive research programs for Pongo pygmaeus TAS2R10 requires integration of multiple approaches and consideration of several key factors:

  • Foundational Characterization:

    • Complete sequence analysis and structural prediction

    • Optimization of expression and purification protocols

    • Development of reliable functional assays

    • Establishment of a baseline pharmacological profile

  • Comparative Frameworks:

    • Parallel studies with human and other primate TAS2R10 orthologs

    • Consideration of orangutan dietary ecology and habitat

    • Ecological relevance of test compounds

    • Evolutionary context within the broader TAS2R family

  • Methodological Integration:

    • Complementary in silico, in vitro, and ex vivo approaches

    • Validation across multiple experimental systems

    • Iterative refinement of computational models

    • Translation from molecular to physiological significance

  • Collaborative Requirements:

    • Expertise spanning molecular biology to ecology

    • Access to orangutan genetic material or databases

    • Computational and structural biology capabilities

    • Potential for field studies or observational data

  • Ethical and Conservation Implications:

    • Non-invasive sampling approaches

    • Respect for endangered species status

    • Potential contributions to conservation efforts

    • Responsible use of recombinant technologies

These considerations will enable development of research programs that not only advance our understanding of taste receptor biology but also contribute to broader knowledge of primate evolution, ecology, and conservation.

How might future research on TAS2R10 contribute to our understanding of orangutan ecology and evolution?

Future research on TAS2R10 could make significant contributions to our understanding of orangutan ecology and evolution:

  • Dietary Adaptation Insights:

    • Correlation between TAS2R10 variants and food preferences

    • Comparison of ligand profiles across orangutan populations

    • Understanding adaptive responses to local plant defensive compounds

    • Historical dietary reconstruction through evolutionary analysis

  • Ecological Niche Specialization:

    • Species-specific adaptations in Pongo pygmaeus versus Pongo abelii

    • Habitat-specific selection pressures on bitter taste perception

    • Role in food selection and toxin avoidance strategies

    • Implications for habitat conservation planning

  • Evolutionary History Reconstruction:

    • Analysis of selection signatures across great ape lineages

    • Dating of adaptive events in relation to species divergence

    • Identification of convergent evolution with other primates

    • Insights into ancestral taste perception capabilities

  • Behavioral and Physiological Connections:

    • Relationship between taste receptor variation and feeding behavior

    • Potential links to medicinal plant use and self-medication

    • Ontogenetic development of taste preferences

    • Social learning of food selection based on taste cues

  • Conservation Applications:

    • Prediction of adaptability to changing food resources

    • Understanding sensory factors in habitat selection

    • Development of more appealing supplementary foods for rehabilitation centers

    • Insights into adaptation potential in fragmented habitats

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.