Recombinant Pongo pygmaeus Taste receptor type 2 member 14 (TAS2R14)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
TAS2R14; Taste receptor type 2 member 14; T2R14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Pongo pygmaeus (Bornean orangutan)
Target Names
Target Protein Sequence
MGGVIKNISTFVLIVEFIIGNLGNSFIALVNCIDWVKRRKISLVDQLLTALAISRISLVW LIFGSWCVSAFFPALFATEKMFRMLTNIWAVTNHFSVWLATGLGTFYFLKIANFSNSIFI YLKWRVKKVVLVLLLVTSVFLFLNIALINIHINASINGYGGNKTCSSDSNDFTRFSSLIA LTSSVFIFIPFILSLAIFLLLTFSLWKHCKKMQHTVKASGDASTKAHRGVMQTVIAFLLL YPIFSLSFFIAVWTSGWLEENLIILSQVMGMAYPSCHSCILILGNKKLRQASLSVLWWLK YRFKDGEPSGHKGFRESS
Uniprot No.

Target Background

Function
This receptor plays a potential role in perceiving bitterness and is linked to gustducin. It may also contribute to sensing the chemical composition of the gastrointestinal contents. Activation of this receptor might stimulate alpha gustducin, mediate PLC-beta-2 activation, and subsequently lead to the gating of TRPM5.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structure of TAS2R14 and how does it compare between Pongo pygmaeus and humans?

TAS2R14 belongs to the G-protein-coupled receptor (GPCR) superfamily and is organized in the genome in clusters that are genetically linked to loci influencing bitter perception . As a member of the human bitter taste receptor family, it contains seven transmembrane domains, typical of GPCRs . Recent research using advanced electron microscopy (cryo-EM) technology has revealed the three-dimensional structure of the receptor, particularly when bound with anti-inflammatory drugs like flufenamic acid (FFA) . The most significant recent discovery is a hidden "pocket" inside the TAS2R14 receptor that allows certain molecules to bind simultaneously at two different points - one outside the cell and another inside it . This dual binding mechanism is unusual and explains the receptor's versatility in binding diverse compounds . While specific structural differences between human and Pongo pygmaeus TAS2R14 aren't explicitly detailed in available research, comparative analysis would be valuable for understanding species-specific adaptations in bitter taste perception.

How does TAS2R14 achieve its remarkably broad activation spectrum?

TAS2R14 has been demonstrated to have extremely broad activation spectra toward a large variety of putative bitter tastants that are structurally very divergent . This extraordinary versatility might explain how mammals can recognize thousands of different bitter-tasting molecules with a limited number of bitter taste receptors . The recently discovered hidden binding pocket provides mechanistic insight into this broad tuning . The receptor's ability to bind at two different points simultaneously allows it to accommodate molecules with diverse chemical structures . For researchers, this broad activation profile makes TAS2R14 an excellent model for studying receptor-ligand interactions and developing modulatory compounds. Structure-based modeling approaches have successfully designed new TAS2R14 agonists with improved potency compared to lead compounds, demonstrating that even with low-resolution homology models, effective ligand design is possible .

What methodologies are most effective for studying TAS2R14 ligand binding properties?

Structure-based molecular modeling integrated with experimental data has proven highly effective for studying TAS2R14 ligand interactions . This approach was successfully employed to design flufenamic acid derivatives as new TAS2R14 agonists . Remarkably, even with low-resolution homology models (approximately 10% sequence identity to the template), researchers achieved significant success: 6 out of 11 molecules suggested by docking screening were confirmed as active compounds with EC50 values comparable or superior to flufenamic acid . The approach involves:

  • Initial homology modeling based on available GPCR structures

  • Docking of known ligands to refine the model

  • Structure-based virtual screening to identify potential new ligands

  • Experimental validation through in vitro screening

  • Medicinal chemistry optimization

  • Model refinement based on structure-activity relationships

This iterative process allows for progressive improvement of structural understanding and more accurate ligand prediction . The refined TAS2R14 model can effectively discriminate between active and inactive compounds and serves as a valuable tool for guiding future hit optimization processes .

Where is TAS2R14 expressed beyond taste buds, and what are its extra-oral functions?

TAS2R14 was first identified in taste buds but has subsequently been discovered in various extra-oral systems where it exerts diverse physiological effects . Research shows that TAS2R receptors are involved in many processes beyond taste perception, including breathing, digestion, and immune system function . TAS2R14 is suggested to have physiological roles related to innate immune responses, male fertility, and cancer . This widespread expression pattern indicates that the receptor's function extends far beyond its originally understood role in bitter taste perception . For researchers investigating TAS2R14, it's essential to consider both its gustatory and non-gustatory roles to comprehensively understand its biological significance. The discovery that these receptors can sense not only external but also internal stimuli opens new avenues for understanding how cells monitor their environment and respond to chemical signals .

How do environmental factors influence TAS2R14 expression and function?

While the search results don't directly address environmental influences on TAS2R14 expression, researchers should consider how factors such as diet, inflammation, or disease states might modulate receptor levels and activity. Given its expression in respiratory and digestive tissues, environmental exposures through these routes might be particularly relevant. Experimental designs might include:

  • Comparing receptor expression in tissues exposed to different environmental conditions

  • Analyzing how inflammatory mediators affect receptor signaling

  • Investigating whether dietary compounds can act as receptor modulators

  • Determining if exposure to certain environmental factors alters receptor sensitivity or desensitization

Understanding these environmental influences could provide insights into how TAS2R14 contributes to physiological adaptations and potentially to pathological conditions.

What signaling pathways are activated by TAS2R14 in different tissue contexts?

TAS2R14, as a G-protein-coupled receptor, likely couples to specific G-proteins to initiate downstream signaling cascades. The specific pathways may differ between tissues, explaining the diverse physiological effects of receptor activation. For researchers investigating these signaling mechanisms, approaches might include:

  • Phosphoproteomic analysis to identify activated pathways

  • Use of pathway-specific inhibitors to dissect signaling components

  • CRISPR-based screens to identify essential signaling mediators

  • Comparison of signaling outcomes in different cell types expressing TAS2R14

These approaches would help elucidate how a single receptor can mediate diverse physiological responses in different tissue contexts.

What expression systems are optimal for producing functional recombinant Pongo pygmaeus TAS2R14?

Based on the search results, recombinant Pongo pygmaeus TAS2R14 can be produced in multiple expression systems including yeast, E. coli, baculovirus, and mammalian cells . Each system offers distinct advantages depending on research objectives:

Expression SystemAdvantagesConsiderationsBest For
E. coliHigh yield, cost-effective, rapidLimited post-translational modificationsStructural studies, antibody production
YeastEukaryotic modifications, high yieldDifferent glycosylation patternsFunctional studies requiring some PTMs
BaculovirusNear-native modifications, good foldingMore complex, time-consumingHigh-quality functional studies
Mammalian cellsNative-like modifications, authentic foldingLower yield, expensiveSignaling studies, drug screening

For structural studies, E. coli-expressed protein may be sufficient, particularly if combined with in vitro refolding protocols . For functional studies investigating signaling or ligand binding, mammalian or baculovirus systems might be preferred to ensure native-like receptor conformation and post-translational modifications . The protein is typically provided as a lyophilized powder that should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

What are the key considerations for reconstitution and storage of recombinant TAS2R14?

For optimal handling of recombinant TAS2R14 protein, researchers should follow these guidelines:

  • Reconstitution: Briefly centrifuge the vial prior to opening to bring contents to the bottom, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Storage: Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C . The default final concentration of glycerol is typically 50% .

  • Stability: Avoid repeated freeze-thaw cycles . Working aliquots may be stored at 4°C for up to one week .

  • Buffer conditions: Tris/PBS-based buffer with 6% Trehalose, pH 8.0 is recommended as a storage buffer .

These handling procedures help maintain protein stability and functional integrity, which is crucial for obtaining reliable experimental results.

How can researchers verify the structure and function of recombinant TAS2R14?

To ensure the quality and functionality of recombinant TAS2R14, researchers should implement multiple validation approaches:

  • Structural verification:

    • SDS-PAGE to confirm purity (>85% is typically considered acceptable)

    • Western blotting with specific antibodies to verify identity

    • Mass spectrometry for accurate molecular weight determination

    • Circular dichroism to assess secondary structure content

  • Functional validation:

    • Ligand binding assays using known agonists like flufenamic acid

    • Calcium mobilization assays in cells expressing the recombinant receptor

    • GTPγS binding assays to measure G-protein coupling

    • Comparison with known functional parameters of human TAS2R14

These validation steps are essential to ensure that experimental results obtained with the recombinant protein accurately reflect the native receptor's properties.

How can structure-based modeling be optimized for designing novel TAS2R14 modulators?

Structure-based modeling for TAS2R14 has been successfully applied despite the challenges of working with low-resolution homology models . To optimize this approach, researchers should:

  • Incorporate experimental data to iteratively refine models. The successful development of flufenamic acid derivatives demonstrates the value of this approach .

  • Implement molecular dynamics simulations to explore receptor flexibility and binding pocket conformations.

  • Consider water molecules in the binding site, as they often play crucial roles in ligand recognition.

  • Utilize fragment-based approaches to identify novel scaffolds with activity at TAS2R14.

  • Apply bioisosteric replacement strategies, which have proven successful in developing new TAS2R14 agonists .

The refined structural model enables discrimination between active and inactive compounds and serves as a valuable tool for guiding future hit optimization processes . This approach provides a general framework for structure-based discovery even in the absence of closely related experimental structures .

What potential therapeutic applications exist for TAS2R14 modulators?

Given that TAS2R14 is expressed in various extra-oral tissues and is involved in processes such as breathing, digestion, and immune responses, modulating its function holds therapeutic potential . The discovery of a hidden binding pocket opens new possibilities for drug design, particularly for conditions such as:

  • Respiratory disorders: TAS2R14 modulators might influence bronchodilation and anti-inflammatory responses in asthma .

  • Inflammatory conditions: The receptor's role in immune function suggests anti-inflammatory applications .

  • Digestive disorders: Given its expression in the digestive tract, TAS2R14 modulators might influence gastrointestinal function .

  • Cancer: The suggested role in cancer biology indicates potential anticancer applications .

Higher potency ligands are needed to investigate TAS2R14 function and to modulate it for future clinical applications . The rational design of agonists has already produced compounds with improved potency compared to lead compounds like flufenamic acid .

How can cross-species comparative studies of TAS2R14 inform evolutionary biology?

Comparative studies of TAS2R14 across species, including Pongo pygmaeus and humans, can provide valuable insights into the evolution of taste perception and its relationship to dietary adaptations. Research approaches might include:

  • Sequence analysis to identify conserved and divergent regions, particularly in binding domains

  • Functional comparison of orthologous receptors using standardized ligand panels

  • Correlation of receptor properties with dietary specializations across primate species

  • Investigation of selective pressures on TAS2R14 genes through population genetics approaches

  • Comparison of extra-oral functions across species to understand the evolution of pleiotropic roles

These comparative studies could reveal how selection pressures have shaped TAS2R14 function in different primate lineages and illuminate the evolutionary history of bitter taste perception.

How should researchers analyze dose-response data for TAS2R14 agonists?

When analyzing dose-response data for TAS2R14 agonists, researchers should employ robust analytical approaches:

  • Use non-linear regression to determine key pharmacological parameters:

    • EC50 (half-maximal effective concentration)

    • Emax (maximum effect)

    • Hill slope (indicative of cooperativity)

  • For comprehensive characterization, construct comparative tables like:

AgonistEC50 (μM)Relative Efficacy (%)Hill CoefficientReceptor Selectivity
Flufenamic Acid0.4100 (reference)1.2Primarily TAS2R14
Compound 100.31101.1TAS2R14/TAS2R39
Compound 140.2951.3TAS2R14 selective
  • Consider multiple functional readouts when possible (calcium flux, receptor internalization, etc.)

  • Apply appropriate statistical tests to determine significant differences between compounds

  • Look for structure-activity relationships to guide further optimization

This systematic approach allows for quantitative comparison between different agonists and facilitates the identification of compounds with improved properties .

What are the critical controls for functional assays with recombinant TAS2R14?

For reliable functional assays with recombinant TAS2R14, researchers should implement comprehensive controls:

  • Positive controls:

    • Known agonists like flufenamic acid at defined concentrations

    • Reference compounds with well-characterized potency and efficacy

  • Negative controls:

    • Vehicle controls (solvent only)

    • Non-activating structural analogs of test compounds

    • Untransfected cells or cells expressing non-functional receptor mutants

  • System validation controls:

    • Internal standards to normalize between experiments

    • Concentration-response curves for reference compounds in each experiment

    • Positive controls for signaling pathway function independent of receptor activation

  • Specificity controls:

    • Testing compounds on related receptors to assess selectivity

    • Competitive binding assays with known ligands

These controls help distinguish specific receptor-mediated effects from non-specific or artifactual responses, ensuring the reliability and reproducibility of experimental results.

How might single-cell analysis techniques advance our understanding of TAS2R14 biology?

Single-cell analysis techniques could provide unprecedented insights into TAS2R14 biology by revealing cell-to-cell variability in receptor expression, signaling, and functional outcomes. Potential applications include:

  • Single-cell RNA sequencing to map TAS2R14 expression across diverse cell types within tissues

  • Single-cell proteomics to correlate receptor levels with signaling components

  • Live-cell imaging of receptor trafficking and internalization dynamics

  • Single-cell analysis of signaling responses to identify responder/non-responder populations

  • Spatial transcriptomics to map receptor expression in the context of tissue architecture

These approaches could reveal previously unrecognized heterogeneity in receptor expression and function, potentially explaining varied responses to bitter compounds and TAS2R14 modulators.

What role might TAS2R14 play in host-microbiome interactions?

Given TAS2R14's expression in digestive and immune tissues, it might mediate interactions between host cells and the microbiome. Research questions to explore include:

  • Do microbial metabolites act as TAS2R14 ligands?

  • Does TAS2R14 activation influence antimicrobial responses?

  • How does the microbiome composition affect TAS2R14 expression and function?

  • Could TAS2R14 modulators affect the microbiome composition?

Understanding these interactions could provide insights into how bitter taste receptors contribute to host defense and microbial homeostasis, potentially revealing new approaches for modulating host-microbiome interactions in health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.