Recombinant Pongo pygmaeus Taste receptor type 2 member 16 (TAS2R16)

Shipped with Ice Packs
In Stock

Description

Molecular Overview of Recombinant TAS2R16

TAS2R16 is a 291-amino-acid protein with a seven-transmembrane domain structure characteristic of GPCRs. Key features include:

  • Host systems: Expressed in E. coli or mammalian cells (e.g., HEK293) .

  • Tagging: Often includes His-tags for purification .

  • Function: Binds β-glycosides via a hydrophobic pocket spanning transmembrane domains (TM3 and TM7), enabling broad ligand specificity while maintaining high sensitivity .

PropertyDetails
SourcePongo pygmaeus (Bornean orangutan)
Expression HostsE. coli, HEK293, other mammalian cells
TagHis-tag (common), Avi/Fc tags (optional)
Storage BufferTris-based buffer with 50% glycerol
Key ResiduesW261 (critical for ligand specificity), N89, E262, V265, S275 (signaling)

Structure-Function Relationships

TAS2R16’s ligand-binding mechanism involves a dynamic interaction between TM3 and TM7 domains:

  • Critical residues: Mutations at W261 (TM7) alter binding affinity for glycosides. For example:

    • W261A: Reduces salicin activation by >10-fold but enhances 4-nitrophenyl-glycoside binding .

    • N96T: Increases sensitivity to salicin and 4-NP-β-mannoside by ~5-fold .

MutationEffect on Ligand Binding
W261A↓ Salicin/phenyl-β-glucoside activation (EC₅₀ ↑ >10-fold); ↑ 4-NP-glycoside activation
N96T↓ EC₅₀ for salicin and 4-NP-β-mannoside (~5-fold)
E262AAbolishes signaling for all ligands (critical for G-protein coupling)

Evolutionary and Functional Insights

TAS2R16’s genetic diversity reflects adaptive pressures linked to diet and toxin avoidance:

  • Positive selection: In Eurasian populations, haplotypes with derived alleles (e.g., functional and regulatory polymorphisms) show signals of recent positive selection, particularly in hunter-gatherer groups like the Mbuti Pygmies .

  • Genetic drift: Contrasting studies suggest drift may dominate in Sahelian populations, with no strong evidence of selection .

PopulationSelection Signal
EurasianStrong positive selection in most groups (LRH analysis)
Mbuti PygmiesHighest selection signal (African hunter-gatherers)
Mesopotamia/ChinaNo selection signal (sedentary agricultural populations)
SahelianGenetic drift dominates (no strong selection evidence)

Recombinant Protein Production and Applications

Recombinant TAS2R16 is used in:

  • ELISA assays: Quantitative detection of receptor-ligand interactions (e.g., salicin, 4-NP-glycosides) .

  • Mutagenesis studies: Mapping critical residues for signaling and ligand specificity .

  • Bitter taste research: Exploring receptor plasticity and cross-species differences (e.g., human vs. rodent TAS2R16) .

ApplicationDetails
ELISA KitsRecombinant protein (50 µg) in Tris/glycerol buffer (source: Pongo pygmaeus)
MutagenesisLibrary of 573 single-residue mutations to identify functional residues
Cross-Species StudiesHuman TAS2R16 transgenic mice show altered bitter perception

Pathway Involvement and Interactions

TAS2R16 participates in multiple signaling pathways:

PathwayKey Proteins
G alpha (i) signalingPYYA, RGS21, HRH3, CASR, TAS2R7
GPCR downstream signalingDRD2, DGKG, APLNR, OPN1LW1
Taste transductionTAS2R40, PLCB2, GNb3, TAS1R1

Research Challenges and Future Directions

  • Structural elucidation: No crystal structure exists; homology modeling relies on class A GPCR templates .

  • Ligand design: Leveraging TAS2R16’s plastic binding pocket to develop high-affinity bitter blockers .

  • Evolutionary trade-offs: Balancing broad ligand recognition with specificity remains a key question .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specified tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R16; Taste receptor type 2 member 16; T2R16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Pongo pygmaeus (Bornean orangutan)
Target Names
Target Protein Sequence
MIPIQLTVFFMIIYVLESLTIIVQSSLIVAVLGREWLQVRRLMPVDMILISLGISRFCLQ WASMLNNFCSYLNLNYVLCNLTITWEFFNILTFWLNSLLTVFYCIKVSSFTHHIFLWVRW RILRWFPWILLGSLTIACVTIIPSAIGNYIQIQLLTMEHLPRNSTVTDRLEKFHQYQFQS HTVALVIPFILFLASTILLMASLTKQIQHHSTGHCNPSMKAHFTALRSLAILFIVFTSYF LIILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSSPTLKRILKGKC
Uniprot No.

Target Background

Function
This receptor may play a role in the perception of bitterness and is gustducin-linked. It may function as a bitter taste receptor for the phytonutrient beta glucopyranosides, some of which are toxic and some of which reduce the risk of cancer and cardiovascular disease. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to the gating of TRPM5.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is TAS2R16 and what is its role in taste perception?

TAS2R16 is a bitter taste receptor belonging to the G protein-coupled receptor (GPCR) family. It plays a crucial role in detecting bitter compounds, particularly β-glycosides such as salicin. This receptor helps define gustatory perception and dietary preferences that ultimately influence health and disease .

The receptor has evolved to achieve a balance between broad reactivity and high specificity, allowing it to detect diverse bitter toxins without causing all foods to taste bitter. Research has shown that TAS2R16 responds not only to β-glucosides but also to β-mannosides, suggesting it has a broader role in bitter taste detection than previously thought .

What are the key structural features of TAS2R16?

TAS2R16 contains several critical structural features essential for its function:

  • 90% of critical residues (35 of 39) cluster within the transmembrane (TM) domains

  • The highest concentration of critical residues is found in TM3 (9 residues) and TM5 (8 residues)

  • The predominance of critical residues in TM3 and TM5 is comparable to class A GPCRs, where these helices undergo significant conformational changes upon activation

The receptor appears to utilize a two-faced binding pocket, with hydrophobic residues on TM3 and TM7 forming a broad ligand-binding pocket that can accommodate diverse structural features of β-glycoside ligands while still achieving high specificity .

What types of ligands does TAS2R16 bind to?

The receptor shows selectivity in its binding preferences, notably not responding to β-galactosides. Its ability to detect phenolic β-mannosides and more complex phenolic β-glucosides from plants suggests that TAS2R16 may be an important determinant of herbivore food selection and has a broader role in bitter detection than previously understood .

What methodologies are most effective for studying the binding pocket of recombinant Pongo pygmaeus TAS2R16?

Several complementary methodologies have proven effective for studying the binding pocket of TAS2R16, which can be applied to recombinant Pongo pygmaeus TAS2R16:

  • Comprehensive Mutation Library Analysis: Creating a comprehensive mutation library of TAS2R16 and testing each variant against multiple ligands has successfully mapped interactions with agonists, identifying 13 TAS2R16 residues that contribute to ligand specificity and 38 residues crucial for signal transduction .

  • Heterologous Expression Systems: Expression in HEK-293T cells co-transfected with a plasmid expressing a Gα16 chimera containing the last 44 amino acids of rat gustducin (Gα16gust44) has been successfully used for functional analysis of TAS2R16 variants .

  • Dose-Response Analyses: Conducting dose-response analyses with various ligands (salicin, 4-NP-β-mannoside, phenyl-β-glucoside, etc.) helps determine how specific substitutions affect ligand activation of TAS2R16 .

How can mutagenesis be effectively used to study TAS2R16 function?

Mutagenesis approaches have proven highly effective for studying TAS2R16 function, as demonstrated in the research:

  • Random PCR Mutagenesis: Utilizing diversity mutagenesis kits for random PCR mutagenesis provides a comprehensive library covering the entire TAS2R16 receptor .

  • Site-Directed Mutagenesis: Targeting specific polymorphic sites, such as position 96 or 172, allows for detailed functional characterization of naturally occurring variants .

  • Natural Variant Analysis: Comparing naturally occurring variants, such as the N96T polymorphism that differs between higher primates and other organisms, provides evolutionary insights into receptor function .

  • Quantitative Functional Assessment: For each mutation, measuring both receptor surface expression and functional responses to ligands through dose-response curves allows quantification of how mutations affect different aspects of receptor function .

Table 1: Effect of Nonsynonymous Variants on TAS2R16 Receptor Surface Expression

PositionWild-typeVariantEffect on Surface ExpressionFunctional Impact
172NK~1.5-2 fold decreaseDecreased sensitivity to salicin
96NTNot specified~5-fold decrease in EC50 for salicin and 4-NP-β-mannoside
261WANot specifiedLigand-dependent: Loss of function for most ligands, gain of function for 4-nitrophenyl compounds
114Wild-typeDerived~2-fold decreasePotential alteration in receptor function

How do specific mutations in TAS2R16 affect its ligand binding capacity and signal transduction?

Research has revealed that different mutations in TAS2R16 can have varied effects on ligand binding and signal transduction:

  • Position 172 (N172K): The N172K polymorphism shows decreased sensitivity to salicin. The N172 variant expresses approximately 1.5- to 2-fold higher than the K172 variant, providing a molecular basis for the observed difference in sensitivity .

  • Position 96 (N96T): This mutation decreases the EC50 for TAS2R16 activation by both salicin and 4-NP-β-mannoside by approximately 5-fold, resulting in greater sensitivity for TAS2R16 ligands .

  • Position 261 (W261A): This mutation shows ligand-dependent effects:

    • Increased EC50 values (reduced sensitivity) for salicin and phenyl-β-glucoside

    • Decreased EC50 values (enhanced sensitivity) for 4-NP-β-mannoside and 4-NP-β-glucoside

    This suggests that the 4-nitrophenyl substitution significantly influences ligand binding and may enable different binding modes .

  • Critical Signal Transduction Residues: 38 residues were identified whose mutation eliminated signal transduction by all ligands, indicating their essential role in the general signaling mechanism rather than specific ligand interactions .

What are the evolutionary implications of differences in TAS2R16 between humans and Pongo pygmaeus?

The evolutionary implications of differences in TAS2R16 between humans and other primates like Pongo pygmaeus reveal adaptive mechanisms in taste perception:

  • Position 96 Variation: A comparison of TAS2R16 sequences across species showed that asparagine is found at position 96 only in higher primates, while other organisms, including potentially Pongo pygmaeus, have threonine at this position. The N96T mutation results in greater sensitivity for TAS2R16 ligands, suggesting potential differences in bitter taste perception between humans and other primates .

  • Selective Pressure: Previous genetic analysis of TAS2R16 found evidence for positive selection influencing patterns of diversity at this locus in Africans, suggesting adaptive evolution of this receptor .

  • Functional Differences: The observed differences in receptor function between species may reflect adaptations to different dietary environments and potential toxic compounds encountered in those environments. This could provide insights into the dietary preferences and adaptive strategies of different primate species, including Pongo pygmaeus .

What are the best approaches for comparing TAS2R16 function across different primate species?

To effectively compare TAS2R16 function across different primate species, including humans and Pongo pygmaeus, researchers should implement the following approaches:

  • Standardized Expression Systems: Express TAS2R16 from different species in the same heterologous expression system to ensure that observed functional differences are due to receptor sequence differences rather than expression system variations .

  • Consistent Methodology: Use identical methodologies for measuring receptor expression, trafficking, and activation across all species being compared:

    • Surface expression measurements using standardized antibody-based detection

    • Calcium flux or other second messenger assays under identical conditions

    • Consistent dose-response protocols for EC50 determination

  • Comprehensive Ligand Panels: Test a diverse panel of ligands, including both natural and synthetic compounds, to fully characterize the receptors' ligand specificity profiles:

    • β-glucosides (e.g., salicin, phenyl-β-glucoside)

    • β-mannosides (e.g., 4-NP-β-mannoside)

    • Compounds with various R-group substitutions

  • Mutational Analysis and Chimeric Receptors: Create targeted mutations at positions that differ between species to determine their contribution to any observed functional differences, and construct chimeric receptors combining domains from different species to identify regions responsible for species-specific differences in function .

What expression systems are most suitable for recombinant Pongo pygmaeus TAS2R16 production?

Based on the search results and best practices for recombinant GPCR production, several expression systems could be suitable for Pongo pygmaeus TAS2R16:

  • E. coli Expression System: The search results indicate successful use of E. coli for expressing recombinant Pongo pygmaeus TAS2R10 (a related bitter taste receptor) . This system offers:

    • High yield and low cost

    • Simplified purification protocols

    • Limitations for properly folding complex membrane proteins

  • Mammalian Cell Lines (HEK-293T): The search results demonstrate successful expression of TAS2R16 variants in HEK-293T cells for functional studies . This system provides:

    • Native-like environment for proper folding

    • Appropriate post-translational modifications

    • Direct functional testing capabilities

    • Lower yields compared to microbial systems

The specific expression parameters for recombinant Pongo pygmaeus TAS2R10 protein production that may be adapted for TAS2R16 include:

Table 2: Recombinant Pongo pygmaeus TAS2R Expression Parameters

ParameterSpecificationNotes
Expression HostE. coliFor protein production
TagHisN-terminal for purification
FormLyophilized powderAfter purification
Storage BufferTris/PBS-based, 6% Trehalose, pH 8.0For stability
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)With 5-50% glycerol for long-term storage
Storage-20°C/-80°CAvoid repeated freeze-thaw cycles

What techniques are most effective for measuring TAS2R16 receptor activation in response to various ligands?

Based on the research methodologies described in the search results, several techniques have been effectively used to measure TAS2R16 receptor activation:

  • Cell-Based Functional Assays: The research utilized cell-based assays to measure receptor activation through downstream signaling .

  • Dose-Response Analyses: Detailed dose-response analyses with various ligands (salicin, 4-NP-β-mannoside, phenyl-β-glucoside, and 4-NP-β-glucoside) were conducted to determine EC50 values for receptor activation and compare responses across different receptor variants .

  • Surface Expression Measurement: A critical complementary technique involves measuring cell surface expression through immunofluorescence and flow cytometry to ensure that changes in functional responses are not simply due to differences in receptor expression levels .

For optimal characterization of recombinant Pongo pygmaeus TAS2R16 activation, researchers should implement a combination of these approaches with careful experimental controls:

  • Expression level normalization between human and Pongo pygmaeus receptors

  • Side-by-side testing with identical assay conditions

  • Multiple ligand testing to identify potential differences in ligand selectivity

  • Verification of proper receptor trafficking to the cell surface

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.