Recombinant Pongo pygmaeus Taste receptor type 2 member 20 (TAS2R20)

Shipped with Ice Packs
In Stock

Description

Genetic and Evolutionary Insights

Studies on TAS2R20 reveal:

  • High Nucleotide Diversity: π = 0.358%, exceeding 95% of human genome loci .

  • Population Differentiation: FST = 0.258, indicating significant divergence across global populations .

  • Functional Polymorphisms: Among 721 SNPs in TAS2Rs, 525 are nonsynonymous, with 239 predicted to alter receptor function .

Comparative Genetic Metrics for TAS2R20

MetricValuePercentile (Genome-wide)
Nucleotide Diversity (π)0.358%98.6%
Tajima’s D-0.2598th
FST0.25898th

These metrics suggest TAS2R20 has undergone unique evolutionary pressures, potentially linked to dietary adaptations .

Bitter Ligand Detection

  • In Vitro Assays: TAS2R20 is utilized in bioluminescence-based calcium release assays to identify bitter compounds. Modifications to its N-terminal signal sequence enhance plasma membrane expression, improving assay sensitivity .

  • Extra-Oral Functions: Beyond taste, TAS2Rs like TAS2R20 are implicated in airway constriction, gut hormone secretion, and pathogen defense .

Comparative Genomics

  • Amphibian vs. Primate TAS2Rs: Frogs and salamanders exhibit expanded TAS2R clusters, whereas primates like Pongo pygmaeus retain conserved bitter receptors for ecological toxin detection .

Industrial and Clinical Relevance

  • Drug Discovery: Recombinant TAS2R20 aids in screening bitter-masking agents for pharmaceuticals .

  • Toxicology Studies: Used to assess plant alkaloids and environmental toxins .

Limitations and Future Directions

  • Functional Redundancy: Overlaps with TAS2R49 (synonymous gene) complicate ligand specificity studies .

  • Structural Data Gaps: Lack of crystallographic data limits mechanistic insights into activation pathways .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it.
Synonyms
TAS2R20; TAS2R49; Taste receptor type 2 member 20; Taste receptor type 2 member 49; T2R49
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Pongo pygmaeus (Bornean orangutan)
Target Names
Target Protein Sequence
MMSFLHIVFSILVLVAFILGNFANGFIALTNFIAWVKRQKISSADQIIAALAVSRVGLLW VILLHWYSTVLNPTSSSLKVTIFVSNAWAVTNHFSIWLATSLSIFYLRKIVNFSRLIFHH LKRKAKSVVLVIVLGALFFLVCHLVMENTYINVWTKEYEGNVTWKIKLRNAMYLSNLTVA TLANLIPFTLTLISVLLLIYSLCKHLKKMQLHGKGSQDPSTKIHIKALQTVTSFLILLAI YFLCLIISFWXSETQLKELVLMLCQAVGIIYPSFHSFILIWGNKTLRQTFLSVLWQVTCW SKGQNQSTP
Uniprot No.

Target Background

Function
This receptor potentially plays a role in perceiving bitterness and is linked to gustducin. It may also contribute to sensing the chemical composition of gastrointestinal content. Activation of this receptor can stimulate alpha gustducin, mediate PLC-beta-2 activation, and ultimately lead to the gating of TRPM5.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.