Recombinant Pongo pygmaeus Taste receptor type 2 member 30 (TAS2R30)

Shipped with Ice Packs
In Stock

Description

Functional and Evolutionary Significance

TAS2R30 is part of a rapidly evolving gene family influenced by dietary pressures. Key findings include:

  • Diet-Driven Evolution: Primate TAS2R genes, including TAS2R30, show duplication events correlated with dietary specialization, particularly in Cercopithecidae species .

  • Cluster Localization: TAS2R genes often reside near telomeres, promoting tandem duplication and functional diversification .

  • Extra-Oral Roles: Beyond taste, TAS2Rs are expressed in gut, brain, and respiratory tissues, suggesting roles in toxin detection and metabolic regulation .

Genetic Diversity Studies

  • Copy Number Variation (CNV): The TAS2R30-31 cluster exhibits high genetic diversity, with structural variations linked to bitter perception differences across populations .

  • Amphibian vs. Primate Evolution: While amphibians expanded TAS2Rs via telomeric clustering, primates like P. pygmaeus show lineage-specific duplications tied to folivory or omnivory .

Functional Assays

  • Recombinant TAS2R30 enables in vitro studies of receptor-ligand interactions, particularly for bitter compounds like alkaloids .

  • Used to explore extra-oral TAS2R roles in immune response and gut-brain signaling .

Challenges and Limitations

  • Partial Protein: The 1–319 aa sequence lacks full-length functionality, restricting studies on complete receptor activation .

  • Species-Specificity: Limited data on P. pygmaeus TAS2R30 ligand specificity compared to human or chimpanzee homologs .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format preferences. Please indicate your desired format in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by normal blue ice packs. If dry ice shipping is required, please contact us in advance for arrangements. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
TAS2R30; TAS2R47; Taste receptor type 2 member 30; Taste receptor type 2 member 47; T2R47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Pongo pygmaeus (Bornean orangutan)
Target Names
Target Protein Sequence
MITFLPIIFSILIVVIFVIGNFANGFIALVNSIEWVKRQKISFADQILIALAVSRVGLLW ALLLHWYATELNLAFYSVEVRITAYNVWAVTNHFSNWLATSLSMFYLLKIANFSNLIFLR IKRRVKSVILVILLGPLLFLVCHLFVINMNEIVWTKEYEGNLTWKIKLRNAVFLSNMTLT MLANFVPLTLTLISFLLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVTCFLLLCAI YFLSMIISVYNFGRLEKKPVFMFCQAITFSYPSTHAFILIWGNKKLKQIFLSVLWHVRYW VKDRSLRLHRFTRAALCKG
Uniprot No.

Target Background

Function
This receptor, potentially involved in bitterness perception, is linked to gustducin. It may play a role in sensing the chemical composition of gastrointestinal contents. The receptor's activity may stimulate alpha gustducin, mediating PLC-beta-2 activation and ultimately leading to the gating of TRPM5.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of TAS2R30 in Pongo pygmaeus compared to humans?

TAS2R30 belongs to the TAS2R30-31 cluster, which in humans includes TAS2R30, -31, -43, -45, and -46. These genes harbor high levels of genetic diversity compared to other TAS2R receptors . While comparisons with chimpanzee genomes have shown intact homologs of TAS2Rs in the cluster, specific research on orangutan TAS2R30 would require comparative genomic analysis to determine conservation of structure, potential copy number variation (CNV), and evolutionary relationships. The genomic position and organization of TAS2R genes can provide insights into their evolutionary history, as seen with the closely positioned TAS2R43 and TAS2R45 loci that exhibit high-frequency deletion alleles in humans .

How does the amino acid sequence of orangutan TAS2R30 influence its ligand specificity?

Like other TAS2R receptors, TAS2R30 likely achieves a balance between broad reactivity to diverse bitter compounds while maintaining specificity for particular molecular structures. Research on TAS2R16 has identified 13 residues that contribute to ligand specificity and 38 residues whose mutation eliminated signal transduction by all ligands . For orangutan TAS2R30, computational modeling based on these findings would suggest that hydrophobic residues on transmembrane helices (particularly TM3, TM5, TM6, and TM7) form a ligand-binding pocket that accommodates diverse bitter compounds while still achieving specificity . Experimental validation through site-directed mutagenesis would be necessary to confirm these predictions.

What are the key structural features that distinguish TAS2R30 from other TAS2R family members?

TAS2R30 likely functions as a monomeric G protein-coupled receptor (GPCR) with seven transmembrane domains, similar to other bitter taste receptors. Unlike sweet and umami receptors (TAS1R family) that function as heterodimers, bitter taste receptors operate independently . Specific differences in amino acid composition within the binding pocket would determine ligand specificity. A comprehensive mutation library approach, similar to that used for TAS2R16 , could identify critical residues that define TAS2R30's unique functional properties.

What expression systems are most effective for functional studies of recombinant orangutan TAS2R30?

Human HEK-293T cells have proven effective for expression and functional characterization of bitter taste receptors, as demonstrated with TAS2R16 . When expressing recombinant orangutan TAS2R30:

  • Include epitope tags to monitor expression:

    • C-terminal V5 epitope tag for assessing full-length translation

    • N-terminal FLAG epitope tag for evaluating surface expression

  • Validate expression through:

    • Western blotting to confirm protein size

    • Immunofluorescence to assess cellular localization

    • Flow cytometry to quantify surface expression levels

  • Optimize codon usage for mammalian expression and consider the addition of export signal peptides to enhance membrane trafficking .

How can mutation libraries be designed to study structure-function relationships in TAS2R30?

A comprehensive mutation library approach, as implemented for TAS2R16, represents the gold standard for structure-function analysis of TAS2R30:

  • Create a complete mutation library with multiple substitutions at each amino acid position (typically one conserved and one non-conserved substitution per position) .

  • Express each variant in a cell-based system arranged in a 384-well format for high-throughput screening.

  • Evaluate receptor function using calcium flux assays upon ligand stimulation.

  • Independently assess full-length translation and surface expression for each variant to distinguish between mutations affecting expression versus function .

  • Focus particular attention on transmembrane domains TM3, TM5, TM6, and TM7, which are likely to form the ligand-binding pocket based on studies of other TAS2Rs .

What functional assays best measure orangutan TAS2R30 activation and signaling?

Calcium mobilization assays represent the primary method for measuring TAS2R activation:

  • Co-express the receptor with a promiscuous G protein (e.g., Gα16-gust44) to couple receptor activation to calcium release.

  • Load cells with calcium-sensitive fluorescent dyes (e.g., Fluo-4 AM).

  • Measure fluorescence changes upon ligand addition using plate readers or automated imaging systems .

  • Include appropriate controls:

    • Wild-type receptor as positive control

    • Mock-transfected cells as negative control

    • Known TAS2R agonists as reference compounds

  • For dose-response measurements, test multiple concentrations to determine EC50 values and compare efficacy across ligands and receptor variants .

How has TAS2R30 evolved across primate species, and what does this reveal about dietary adaptations?

Analysis of TAS2R genes has shown evidence of different selective pressures:

  • Some TAS2R genes (like TAS1R1 and TAS1R3) show worldwide evidence of positive selection, suggesting improved taste perception provided an adaptive advantage .

  • Others (like TAS2R16 and TAS2R38) display patterns more consistent with balancing selection, potentially conferring a heterozygous advantage for perceiving a wider range of bitter compounds .

  • For orangutan TAS2R30, comparative analysis with other primate species would reveal:

    • Nonsynonymous to synonymous substitution ratios (dN/dS)

    • Sites under positive selection

    • Convergent evolution among species with similar diets

    • Potential correlation between receptor variation and dietary specialization

The TAS2R30-31 cluster exhibits particularly high levels of genetic diversity, suggesting important functional consequences of variation in these receptors .

What role does copy number variation play in TAS2R30 evolution across primates?

Copy number variation (CNV) significantly impacts bitter taste receptor evolution:

  • In humans, high-frequency deletion alleles exist for TAS2R43 and TAS2R45, resulting in individuals with 0-2 copies of these genes .

  • Population genetics analyses have revealed that:

    • Deletion frequencies vary across populations

    • Linkage disequilibrium exists between closely positioned loci

    • Recombination rates between adjacent TAS2R genes are low

  • For orangutan TAS2R30, genomic analysis would be necessary to determine:

    • Presence of deletion alleles

    • Copy number distribution across orangutan populations

    • Comparison with CNV patterns in other primates

    • Potential functional consequences of variable copy number

How do coding variants in orangutan TAS2R30 compare with known functional variants in human TAS2Rs?

Nonsynonymous variants in TAS2R genes can significantly impact receptor function:

  • Human TAS2R38 contains three amino acid replacements that alter sensitivity to phenylthiocarbamide (PTC), resulting in nearly 10,000-fold variation in taste sensitivity .

  • Similar associations between genetic variants and functional differences exist for other TAS2R receptors .

  • For orangutan TAS2R30, systematic analysis would involve:

    • Identification of all coding variants within orangutan populations

    • Functional characterization of these variants using cell-based assays

    • Comparison with variants in human TAS2R30 to identify species-specific functional adaptations

    • Correlation of variant distribution with ecological factors

What are the primary challenges in expressing functional recombinant TAS2R30?

Several technical challenges typically affect recombinant bitter taste receptor expression:

  • Poor membrane trafficking: Many GPCRs, including TAS2Rs, show inefficient transport to the plasma membrane in heterologous systems.

    • Solution: Utilize N-terminal tags that enhance surface expression, such as the first 45 amino acids of rat somatostatin receptor type 3 .

    • Validation: Monitor surface expression using N-terminal FLAG epitope tags and immunofluorescence .

  • Protein instability: TAS2Rs may exhibit instability in detergent solutions, complicating purification.

    • Solution: Screen detergents and lipid compositions to identify stabilizing conditions.

    • Validation: Assess protein stability through thermal shift assays and size-exclusion chromatography.

  • Coupling to signaling pathways: Native G protein coupling may be inefficient in heterologous systems.

    • Solution: Co-express chimeric G proteins (e.g., Gα16-gust44) that efficiently couple bitter taste receptors to calcium signaling .

    • Validation: Compare signaling efficiency with known bitter taste receptor-ligand pairs.

How can researchers develop specific ligand screening approaches for orangutan TAS2R30?

Systematic ligand identification requires multi-stage screening:

  • Primary screening:

    • Test compounds present in orangutan natural diet

    • Screen libraries of known bitter compounds

    • Utilize phylogenetic relationships to prioritize compounds that activate related TAS2Rs

  • Structure-activity relationship analysis:

    • Group active compounds by chemical scaffold

    • Identify essential pharmacophore features through systematic modification

    • Use computational docking to predict binding modes

  • Validation approaches:

    • Confirm dose-dependent activation

    • Test receptor specificity by comparing responses across multiple TAS2Rs

    • Validate with structurally related compounds to determine structure-activity relationships

What strategies can overcome the lack of structural information for TAS2R proteins?

No crystal structures currently exist for any TAS2R receptor, presenting significant challenges :

  • Homology modeling approaches:

    • Utilize existing GPCR structures as templates

    • Refine models through molecular dynamics simulations

    • Validate models through experimental testing of predictions

  • Cross-linking and biochemical approaches:

    • Employ disulfide cross-linking to validate proximity of residues

    • Use photoaffinity ligands to identify binding site residues

    • Implement systematic mutagenesis to map functional domains

  • Cryo-EM alternatives:

    • Complex the receptor with nanobodies or antibody fragments to increase stability

    • Utilize lipid nanodiscs to maintain native-like membrane environment

    • Apply single-particle cryo-EM for structural determination

How should researchers analyze data from comprehensive mutation library screens of TAS2R30?

Systematic analysis of mutation library data provides mechanistic insights:

  • Classify mutations based on functional effects:

    • Mutations eliminating signal transduction by all ligands (likely affecting general receptor structure/function)

    • Mutations altering sensitivity to specific ligands (likely within binding pocket)

    • Mutations affecting maximal response (efficacy) versus potency (EC50)

  • Map mutations onto receptor structural models:

    • Identify clusters of functionally important residues

    • Distinguish between ligand-binding residues and those involved in signal transduction

    • Compare patterns with other characterized TAS2Rs to identify conserved mechanisms

  • Create data visualization tools:

    • Heat maps displaying functional effects of all mutations

    • Structure-based visualization of critical residues

    • Pharmacophore models incorporating structure-activity relationships

How can contradictory results in TAS2R30 functional studies be reconciled?

Contradictory results may arise from methodological differences:

  • Expression level variability:

    • Quantify receptor expression levels using epitope tags

    • Normalize functional responses to surface expression

    • Implement consistent transfection protocols and verify expression for each experiment

  • Assay sensitivity differences:

    • Compare calcium mobilization assays with alternative readouts (e.g., cAMP, β-arrestin recruitment)

    • Validate key findings with multiple assay platforms

    • Determine assay dynamic range and sensitivity limits

  • Species and isoform differences:

    • Clearly document the exact receptor sequence used in each study

    • Account for potential splice variants or polymorphisms

    • Consider species-specific differences in signaling components

What statistical approaches best analyze dose-response data from TAS2R30 variants?

Rigorous statistical analysis ensures reliable interpretation:

  • Curve fitting approaches:

    • Fit dose-response data to appropriate models (typically four-parameter logistic function)

    • Extract EC50, Emax, Hill coefficient, and basal activity parameters

    • Compare goodness-of-fit across different models

  • Statistical comparison methods:

    • Use extra sum-of-squares F-test to compare EC50 values

    • Apply ANOVA with appropriate post-hoc tests for multiple comparisons

    • Calculate 95% confidence intervals for all parameters

  • Reproducibility measures:

    • Perform at least three independent experiments with technical replicates

    • Report biological and technical variability separately

    • Use standardized positive controls to enable cross-experiment normalization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.