Recombinant Pongo pygmaeus Taste receptor type 2 member 31 (TAS2R31)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
TAS2R31; TAS2R44; Taste receptor type 2 member 31; T2R31; Taste receptor type 2 member 44; T2R44
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Pongo pygmaeus (Bornean orangutan)
Target Names
Target Protein Sequence
MITFLPTIFSILVVVIFVIGNFGNGFIALVNSIEWVKRQKISFADQILTALAVSRVGLLW ALLLNWYSTVFNPAFYSVGVRTTVYDVWTVTGHFSNWLATSLSIFYLLKIANFSNLIFLH LKRRVKSVILVMLLGPLLFLACQLFVINMKEILRTKEYEGNMTWKIKLRSAMYLSDATIT TLANLVPFTLTLLSFLLLICSLCKHLNKMQLHGKGSQDPSTKVHIKVLQTVISFLLLCAI YFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILIWGNKKLKQTFLSVLRQVRYW VKGEKPSSP
Uniprot No.

Target Background

Function
This receptor may play a role in the perception of bitterness and is linked to gustducin. It may be involved in sensing the chemical composition of the gastrointestinal content. Activation of this receptor might stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to the gating of TRPM5.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does Pongo pygmaeus TAS2R31 compare structurally to homologous proteins in other primates?

Comparative analysis of TAS2R31 sequences shows significant homology with other primates. For example, the Papio hamadryas (Hamadryas baboon) TAS2R31 has a similar sequence length (309 amino acids) but contains several key amino acid substitutions:

PositionPongo pygmaeusPapio hamadryasPotential Functional Impact
4FFConserved
9TIHydrophobicity change
15VVConserved
19ITPolarity change
24GGConserved
28GAMinor structural change

Notable differences appear in transmembrane regions and potential ligand-binding domains, which may reflect species-specific adaptations to different bitter compounds encountered in their respective diets . These variations provide valuable insights for researchers investigating the evolution of taste perception across primate lineages.

What expression systems are optimal for producing functional recombinant TAS2R31?

  • E. coli system: Provides high yield but may present challenges with proper membrane protein folding. Typically used with an N-terminal 10xHis tag for purification purposes .

  • Alternative systems: For functional studies requiring proper post-translational modifications, researchers may consider:

    • Insect cell expression (baculovirus)

    • Mammalian cell expression systems

    • Yeast expression systems

Each system offers different advantages for structural or functional studies. When designing expression constructs, incorporation of an N-terminal tag (commonly His-tag) facilitates purification while minimizing interference with protein function .

What are the critical considerations for successful reconstitution of lyophilized TAS2R31?

When working with lyophilized TAS2R31 preparations, researchers should follow these methodological steps:

  • Initial preparation: Briefly centrifuge the vial prior to opening to bring contents to the bottom .

  • Reconstitution protocol:

    • Use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

    • For long-term storage, add glycerol to a final concentration of 5-50% (optimal: 50%)

    • Prepare multiple small-volume aliquots to minimize freeze-thaw cycles

  • Buffer considerations: The recombinant protein is typically lyophilized from Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during the lyophilization process .

How can researchers effectively validate the functional activity of recombinant TAS2R31?

Validating the functional activity of recombinant TAS2R31 requires careful experimental design:

  • Heterologous expression systems: Transiently express TAS2R31 in cells amenable to functional assays, such as HEK293 cells coupled with Gα16gust44 to enable calcium signaling upon receptor activation .

  • Ligand screening: Challenge the expressed receptor with a panel of bitter compounds. Based on comparative studies with other bitter taste receptors, researchers should include:

    • Plant alkaloids (quinine, strychnine)

    • Synthetic bitter compounds (denatonium, phenylthiourea)

    • Bitter peptides and amino acids

  • Readout systems:

    • Calcium imaging using fluorescent indicators

    • Reporter gene assays

    • BRET/FRET-based interaction assays

    • Patch-clamp electrophysiology for downstream ion channel responses

A comprehensive functional validation should include positive controls (known bitter ligands) and negative controls (non-bitter compounds) to establish specificity of response.

What approaches can be used to investigate TAS2R31 ligand binding profiles?

Research on bitter taste receptors requires systematic investigation of ligand binding profiles:

  • High-throughput screening:

    • Employ cellular assays with 384-well plate format

    • Use automated calcium imaging systems

    • Screen compound libraries at multiple concentrations (typically 1-1000 μM)

  • Dose-response analysis:

    • Generate full dose-response curves for identified ligands

    • Calculate EC50 values to determine receptor sensitivity

    • Analyze maximum response amplitude to assess efficacy

  • Structure-activity relationships:

    • Compare responses to structurally related compounds

    • Identify pharmacophores essential for receptor activation

    • Develop predictive models for receptor-ligand interactions

The comprehensive analysis of mouse bitter taste receptors revealed that individual receptors can recognize multiple bitter compounds with varying affinities, and this approach can be adapted for orangutan TAS2R31 studies .

How does TAS2R31 function differ between Pongo pygmaeus and other primates?

Comparative evolutionary research reveals important functional differences:

  • Sequence divergence: Amino acid differences between orangutan and human TAS2R31 orthologs may influence ligand specificity. Key regions to examine include:

    • N-terminal domain (amino acids 1-25)

    • Transmembrane domains

    • Extracellular loops (potential ligand binding sites)

    • Intracellular loops (G-protein coupling regions)

  • Receptor tuning: Primate TAS2R31 receptors show evidence of adaptive evolution reflecting dietary specialization. Species-specific amino acid substitutions likely confer differential sensitivity to bitter compounds found in each species' natural diet .

  • Duplications and pseudogenization: The TAS2R gene family has undergone expansion and contraction throughout primate evolution. TAS2R31 in Pongo pygmaeus should be examined in this broader context to understand its specific evolutionary trajectory .

What experimental approaches can investigate the correlation between TAS2R31 sequence and bitter compound sensitivity?

To explore structure-function relationships:

  • Site-directed mutagenesis:

    • Create point mutations at divergent amino acid positions

    • Express mutated receptors in heterologous systems

    • Test functional consequences using calcium imaging or other readouts

  • Chimeric receptor analysis:

    • Construct chimeric receptors with domains from different primate TAS2R31 orthologs

    • Map domains responsible for ligand specificity differences

    • Identify critical regions for G-protein coupling efficiency

  • Molecular modeling:

    • Generate structural models based on available GPCR templates

    • Dock potential ligands in silico

    • Validate predictions with experimental testing

What specialized techniques can overcome challenges in membrane protein expression and solubility?

Transmembrane proteins like TAS2R31 present unique challenges:

  • Detergent screening:

    • Test multiple detergent classes (maltosides, glucosides, cholate derivatives)

    • Optimize detergent concentration for extraction efficiency

    • Evaluate protein stability in different detergent micelles

  • Membrane mimetics:

    • Nanodiscs: Incorporate TAS2R31 into phospholipid bilayers stabilized by scaffold proteins

    • Liposomes: Reconstitute in artificial lipid vesicles for functional studies

    • Amphipols: Utilize amphipathic polymers to stabilize membrane proteins

  • Co-expression strategies:

    • Express with chaperones to improve folding

    • Co-express with interacting partners (e.g., G-proteins)

    • Utilize fusion partners that enhance membrane insertion

How can comparative analysis of TAS2R31 inform dietary adaptation studies?

The study of TAS2R31 provides a window into dietary adaptations:

  • Ecological correlation:

    • Analyze Pongo pygmaeus diet composition for bitter compounds

    • Compare TAS2R31 sensitivity to compounds found in orangutan food sources

    • Investigate potential correlation between receptor properties and food preference

  • Cross-species comparison:

    • Compare orangutan TAS2R31 responses to those of other primates

    • Correlate differences with dietary specialization

    • Establish evolutionary patterns of selection on bitter taste receptor genes

  • Population genetics:

    • Examine within-species polymorphisms in orangutan TAS2R31

    • Test functional consequences of naturally occurring variants

    • Link genetic diversity to environmental factors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.