Recombinant Pongo pygmaeus Taste receptor type 2 member 38 (TAS2R38)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant TAS2R38

TAS2R38 is a Class T2 G protein-coupled receptor (GPCR) expressed in Bornean orangutans (Pongo pygmaeus). Its recombinant form retains the structural and functional features of the native receptor, enabling in vitro studies.

Table 1: Sequence Highlights of Recombinant TAS2R38

RegionSequence (Residues)Functional Role
N-terminalMLTLTRICAVSYEVRSTFLF...Ligand recognition domain
TransmembraneSYEV...FLCYLWSVPPFLLFLV...Signal transduction
C-terminalNATLRRAVTTILLWAQSSMKVRADHKADSRTLCInteraction with G-proteins

Production and Purification

Recombinant TAS2R38 is synthesized using heterologous expression systems to ensure high yield and purity:

Expression Systems:

  • Cell-Free Systems: Achieves >85% purity, suitable for structural studies .

  • E. coli/Yeast/Baculovirus: Used for large-scale production with Tris-based storage buffers (50% glycerol) .

Ligand Binding and Signal Transduction

Recombinant TAS2R38 binds bitter compounds like phenylthiocarbamide (PTC) and 6-n-propylthiouracil (PROP) . Molecular dynamics simulations reveal:

  • Agonists interact with residues Asn103, Phe197, Phe264, and Trp201 .

  • Activation triggers Gα-gustducin signaling, leading to calcium release via TRPM5 channels .

Health and Evolutionary Implications

  • Longevity: Homozygosity for the functional PAV haplotype correlates with exceptional human longevity, suggesting TAS2R38’s role in diet-mediated aging .

  • Disease Associations: Variants influence susceptibility to chronic rhinosinusitis, colorectal cancer, and upper respiratory infections .

Mechanistic Studies

  • Ligand Screening: Used to identify bitter compounds in plant-derived foods (e.g., glucosinolates) .

  • Mutagenesis: Over 20 mutants have been analyzed to map functional residues .

Future Directions

  • Structural Biology: Solving cryo-EM structures to refine agonist-binding models .

  • Therapeutic Targeting: Exploring TAS2R38’s role in immune modulation and metabolic disorders .

Recombinant TAS2R38 remains pivotal for decoding bitter taste pathways and their systemic impacts, bridging gaps between sensory biology and precision medicine.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your needs when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. For specific delivery times, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this to us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R38; Taste receptor type 2 member 38; T2R38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Pongo pygmaeus (Bornean orangutan)
Target Names
Target Protein Sequence
MLTLTRICAVSYEVRSTFLFISVLEFAVGFLTNAFIFLVNFWDVVKRQPLSNSDCVLLCL SISRLFLHGLLFLSAIQLTHFQKLSEPLNHSYQAIIMLWIIANQANLWLAACLSLLYCSK LIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVWCFFSRPHFTVTTFLFMNNNT RLNWQIKDLNLFYSFLFCYLWSVPPFLLFLVSSGMLTVSLGRHMRTMKVYTRDSRDPSLE AHIKALKSLVSFFCFFVISSCAAFISVPLLILWRNKIGVMVCVGIMAACPSGHAAVLISG NATLRRAVTTILLWAQSSMKVRADHKADSRTLC
Uniprot No.

Target Background

Function
This receptor may play a role in perceiving bitterness and is linked to gustducin. It might also contribute to sensing the chemical composition of the gastrointestinal content. Activation of this receptor could stimulate alpha gustducin, mediate PLC-beta-2 activation, and subsequently lead to the gating of TRPM5.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the common genetic polymorphisms in TAS2R38 and how should researchers approach haplotype analysis?

The TAS2R38 gene contains three well-characterized single nucleotide polymorphisms (SNPs): rs713598 (G145C, Ala49Pro), rs1726866 (T785C, Val262Ala), and rs10246939 (A886G, Ile296Val) . These SNPs give rise to several haplotypes, with two being predominant in human populations: the PAV (Proline-Alanine-Valine) and AVI (Alanine-Valine-Isoleucine) haplotypes .

When analyzing TAS2R38 haplotypes, researchers should:

  • Use PCR reactions for all three polymorphic variants following standardized protocols

  • Include positive controls for each polymorphic variant

  • Perform allelic discrimination analysis

  • Test for Hardy-Weinberg equilibrium in population studies (e.g., chi-square test with 1 degree of freedom)

Population studies have shown varying distributions of these haplotypes. For example, in one control group, PAV/AVI genotype was found in 53.5% of subjects, followed by AVI/AVI (23.7%) and PAV/PAV (22.8%) . Researchers should always report complete haplotype frequencies in their studies as shown in this example table:

TAS2R38 HaplotypeFrequency (%)
PAV/PAV19.4%
PAV/AVI52.6%
AVI/AVI20.4%
Others7.7%

This comprehensive approach ensures accurate genotyping and proper interpretation of phenotypic associations .

What are the optimal storage and handling conditions for recombinant TAS2R38 protein?

Proper storage and handling of recombinant Pongo pygmaeus TAS2R38 protein is critical for maintaining its structural integrity and biological activity. The recommended storage conditions are:

  • For long-term storage: -20°C or -80°C in a Tris-based buffer containing 50% glycerol optimized for this protein

  • For working aliquots: 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this may compromise protein stability and activity

When designing experiments, researchers should:

  • Prepare small working aliquots to minimize freeze-thaw cycles

  • Optimize buffer conditions based on downstream applications

  • Validate protein activity after storage using functional assays

  • Consider the addition of protease inhibitors when working with cell or tissue lysates

Proper documentation of storage duration and conditions is essential for experimental reproducibility and should be clearly reported in methods sections .

How does TAS2R38 function in taste perception and what methodologies are used to study its activity?

TAS2R38 functions as a bitter taste receptor that specifically responds to compounds containing the thiourea moiety, including phenylthiocarbamide (PTC), propylthiouracil (PROP), and certain glucosinolates found in cruciferous vegetables . To study TAS2R38 activity, researchers employ several methodological approaches:

  • Taste perception assays: Administering PTC solutions (typically 0.025% aqueous solution) on the tongue and recording bitter taste perception. Positive results indicate functional TAS2R38 activity .

  • Calcium imaging: Measuring calcium influx in cells expressing TAS2R38 upon stimulation with ligands. This technique allows for quantitative assessment of receptor activation .

  • Nitric oxide (NO) production assays: Since TAS2R38 activation triggers NO release, measuring NO levels serves as a functional readout of receptor activity .

  • Ciliary beat frequency (CBF) measurements: TAS2R38 activation increases CBF in respiratory epithelial cells, which can be quantified using high-speed digital microscopy .

What is the role of TAS2R38 in respiratory immunity and how can researchers investigate this function?

TAS2R38 plays a significant role in respiratory immunity beyond its function in taste perception. In the respiratory tract, TAS2R38 is expressed primarily in ciliated epithelial cells of the sinonasal cavity, where it acts as a sentinel for detecting bacterial compounds called acyl-homoserine lactones (AHLs) . When activated, TAS2R38 triggers:

  • Calcium-dependent increase in nitric oxide (NO) production

  • Enhanced ciliary beat frequency (CBF)

  • Increased mucociliary clearance (MCC)

  • Augmented antimicrobial peptide (AMP) secretion

These mechanisms collectively contribute to innate immune defense against respiratory pathogens. Notably, NO has been shown to inhibit the replication of viruses, including those in the SARS-CoV family, by impairing spike protein binding to ACE2 and reducing viral RNA synthesis .

To investigate TAS2R38's role in respiratory immunity, researchers should:

  • Employ air-liquid interface cultures of primary respiratory epithelial cells from donors with different TAS2R38 genotypes

  • Measure CBF using high-speed video microscopy before and after exposure to TAS2R38 agonists

  • Quantify NO production using fluorescent indicators or Griess assay

  • Assess antimicrobial peptide secretion using ELISA or mass spectrometry

  • Evaluate bacterial clearance in vitro using labeled pathogens

  • Correlate findings with TAS2R38 genotype/haplotype status

This comprehensive approach allows for mechanistic understanding of how TAS2R38 variants influence respiratory immune responses and susceptibility to infections.

How do TAS2R38 genetic variations correlate with disease susceptibility and what methodological considerations are important?

TAS2R38 genetic variations have been associated with susceptibility to several diseases, particularly those affecting the respiratory tract. Key findings include:

  • Chronic Rhinosinusitis (CRS): Individuals with the AVI/AVI haplotype (non-tasters) appear more vulnerable to severe CRS, while those with PAV/PAV haplotype (tasters) show reduced susceptibility .

  • COVID-19: Evidence regarding TAS2R38 and COVID-19 severity is mixed. Some studies report positive correlations between non-taster status and severe COVID-19 symptoms, while genetic studies show no significant correlation between TAS2R38 haplotype and symptom severity .

  • Dental caries: TAS2R38 polymorphisms may be associated with tooth decay, with certain genotypes showing higher DMFT/dmft scores (Decayed, Missing, and Filled Teeth), though the differences are not always statistically significant .

When investigating these associations, researchers should address these methodological considerations:

  • Sample size and power: Ensure adequate statistical power for detecting differences between genotype groups

  • Case definition: Apply rigorous, standardized criteria for disease diagnosis

  • Confounding factors: Control for variables such as age, sex, comorbidities, and environmental exposures

  • Multiple testing: Apply appropriate statistical corrections when examining multiple SNPs or phenotypes

  • Replication: Validate findings in independent cohorts

  • Functional validation: Complement association studies with functional assays to establish biological plausibility

For example, in CRS studies, researchers should:

  • Use standardized diagnostic criteria (e.g., endoscopic evidence of nasal polyps)

  • Stratify by disease subtype (CRS with or without nasal polyps)

  • Consider comorbidities such as asthma and allergies

  • Include control groups matched for demographic characteristics

What approaches should be used for comparative analysis of TAS2R38 across primate species?

Comparative analysis of TAS2R38 across primate species provides valuable insights into receptor evolution and functional adaptation. When conducting such studies, researchers should implement the following approaches:

  • Sequence alignment and phylogenetic analysis:

    • Collect TAS2R38 sequences from multiple primate species, including Pongo pygmaeus

    • Perform multiple sequence alignment using programs like MUSCLE or CLUSTAL

    • Construct phylogenetic trees using maximum likelihood or Bayesian methods

    • Calculate sequence conservation scores for functional domains

  • Structural modeling:

    • Generate 3D structural models using homology modeling techniques

    • Identify species-specific variations in ligand-binding domains

    • Predict functional consequences of amino acid substitutions using in silico tools

  • Functional comparisons:

    • Express recombinant TAS2R38 from different primate species in heterologous systems

    • Compare receptor activation profiles using calcium imaging or other functional readouts

    • Test responses to a panel of bitter compounds to identify species-specific sensitivities

  • Population genetics analysis:

    • Calculate selection metrics (dN/dS ratios) to identify signatures of positive selection

    • Compare haplotype diversity across species to understand evolutionary pressures

    • Analyze variation within species to identify conserved and variable regions

These approaches should be integrated to provide a comprehensive understanding of how TAS2R38 function has evolved across primates and how the Pongo pygmaeus variant compares to human and other primate homologs .

How can researchers reconcile contradictory findings regarding TAS2R38 polymorphisms and their physiological effects?

Contradictory findings regarding TAS2R38 polymorphisms and their physiological effects are common in the literature. To reconcile these contradictions, researchers should:

  • Critically evaluate methodological differences:

    • Compare sample sizes and statistical power across studies

    • Assess differences in genotyping methods and quality control procedures

    • Evaluate phenotyping approaches and their sensitivity/specificity

    • Consider differences in statistical analyses and adjustment for confounders

  • Account for population stratification:

    • Recognize that TAS2R38 haplotype frequencies vary across populations

    • Consider ancestral background when comparing studies from different regions

    • Use appropriate statistical methods to adjust for population structure

  • Consider gene-environment interactions:

    • Investigate how environmental factors modify genotype-phenotype associations

    • Assess dietary patterns, which may affect TAS2R38-mediated responses

    • Evaluate exposure to environmental pathogens that interact with TAS2R38

  • Examine gene-gene interactions:

    • Consider the influence of other taste receptors (e.g., TAS1Rs) that may work antagonistically with TAS2R38

    • Investigate polygenic effects that may mask single-gene associations

  • Design integrative studies:

    • Combine genetic, functional, and clinical approaches in the same cohort

    • Use longitudinal designs to capture temporal variations in phenotypic expression

    • Employ systems biology approaches to understand pathway-level effects

For example, in COVID-19 research, contradictory findings regarding TAS2R38 and disease severity might be reconciled by considering factors such as viral load, comorbidities, vaccination status, and the timing of genotyping relative to infection .

What are the optimal experimental designs for studying TAS2R38-mediated signaling pathways?

To effectively study TAS2R38-mediated signaling pathways, researchers should implement these optimal experimental designs:

  • Receptor activation studies:

    • Use cell lines expressing recombinant TAS2R38 (wild-type and variant forms)

    • Apply dose-response protocols with known agonists (PTC, PROP, AHLs)

    • Measure calcium mobilization using fluorescent indicators (Fura-2, Fluo-4)

    • Monitor temporal dynamics of receptor activation and desensitization

  • Downstream signaling analysis:

    • Employ phosphoproteomic approaches to identify activated signaling cascades

    • Use selective inhibitors to delineate specific pathway contributions

    • Apply CRISPR/Cas9 gene editing to validate key signaling components

    • Measure nitric oxide production with DAF-FM or other NO-sensitive probes

  • Physiological readouts:

    • For respiratory epithelium: measure ciliary beat frequency using high-speed videomicroscopy

    • For immune function: quantify antimicrobial peptide secretion using ELISA or mass spectrometry

    • For taste cells: record membrane potential changes using patch-clamp electrophysiology

  • Receptor-ligand interaction studies:

    • Perform site-directed mutagenesis to identify critical binding residues

    • Use computational docking to predict ligand binding modes

    • Validate predictions with binding assays (surface plasmon resonance, isothermal titration calorimetry)

  • Systems-level integration:

    • Apply transcriptomic and proteomic analyses to identify global changes upon receptor activation

    • Use pathway enrichment tools to identify biological processes affected by TAS2R38 signaling

    • Develop mathematical models to predict cellular responses to receptor activation

These approaches collectively provide a comprehensive understanding of how TAS2R38 variants influence signaling cascades and downstream physiological processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.