Taste receptor type 2 member 41 (TAS2R41) belongs to the T2R family of G-protein coupled receptors specifically responsible for the detection of bitter compounds. In Pongo pygmaeus (Bornean orangutan), this receptor plays a crucial role in the gustatory system, allowing these primates to detect potentially harmful substances through bitter taste perception. TAS2R41 functions as a gustducin-linked receptor, potentially involved not only in oral taste perception but also in sensing the chemical composition of gastrointestinal contents . The recombinant form of this protein enables detailed scientific investigation into its structure-function relationships and comparative analysis with homologous receptors in other species.
TAS2R41 is classified as a member of the G-protein coupled receptor (GPCR) T2R family. Similar to other proteins in this family, it likely contains seven transmembrane domains characteristic of GPCRs, with intracellular and extracellular loops connecting these domains. The full-length protein consists of 307 amino acids, forming a complex three-dimensional structure embedded in the cell membrane . While the precise three-dimensional structure of Pongo pygmaeus TAS2R41 has not been fully elucidated in the available literature, its membership in the T2R family suggests structural homology with other bitter taste receptors.
The complete amino acid sequence of Pongo pygmaeus TAS2R41 is:
MQAALTATFFMLFFSLSLGIAANGFIVLVLGREWLQYGRLLPLDMILISLGVSRFCLQLVGTVYNFYYSAHKVEYSGGLSRQFFHLHWHFLNLATFXFCSWLSVLFCVKXANITHPTFLWLKWRFPGWVPWLLLGSVLISFIITLLLFWVNYPVYQEFLIRKFSGNMTYEWNTRIEMYYLPSLKLVIWSIPCSVFLVSIMLLINSLRRHTWTRMQHNGHSLQDPSTQAHTRAXKSLISFFILYVLSFLSLIIDATKFISMQNDFYWPWQTAVYLGVSVHPFILIFSNLKLRSVFWKLLLLARGFWVA
This sequence contains several notable features, including hydrophobic regions corresponding to transmembrane domains and potential binding sites for bitter compounds. The presence of 'X' characters in the sequence indicates positions where amino acid identity could not be unambiguously determined in the original sequencing.
The gene encoding TAS2R41 in Pongo pygmaeus is designated as TAS2R41. The recombinant protein is cataloged in the UniProt database with the accession number Q645U6, providing a standardized reference for this specific protein . The expression region of the protein spans positions 1-307, indicating that the recombinant form represents the full-length native protein rather than a truncated version .
TAS2R41 primarily functions in bitter taste perception, a critical sensory mechanism that helps organisms detect potentially harmful substances. As a bitter taste receptor, TAS2R41 likely responds to specific bitter compounds, though the exact ligand specificity for the Pongo pygmaeus variant is not extensively documented in the available literature. By comparison with other T2R family members, it potentially contributes to the orangutan's ability to discriminate between various bitter compounds in their diet, which may include plant alkaloids and other potentially toxic substances .
The activity of TAS2R41 involves several downstream signaling components. Upon activation by bitter compounds, TAS2R41 likely stimulates alpha gustducin (a G-protein subunit specific to taste receptor cells), which then mediates the activation of phospholipase C-beta-2 (PLC-β2) . This cascade ultimately leads to the gating of transient receptor potential cation channel subfamily M member 5 (TRPM5), resulting in membrane depolarization and neurotransmitter release from taste cells . This signaling pathway represents the molecular basis for bitter taste sensation and is conserved across various species, though specific adaptations may exist in Pongo pygmaeus.
The recombinant Pongo pygmaeus TAS2R41 protein is commercially available as a research reagent. It is typically supplied at a quantity of 50 μg, though other quantities may also be available depending on the supplier . The production process involves recombinant DNA technology, whereby the TAS2R41 gene is expressed in a suitable host system to generate the functional protein. The tag type used for purification and detection is determined during the production process and may vary between different preparations .
The recombinant protein is provided in a storage buffer consisting of Tris-based buffer with 50% glycerol, optimized specifically for this protein to maintain its stability and activity . This formulation helps preserve the native conformation and functional properties of the protein during storage and handling.
TAS2R41 functions within a network of interacting proteins that collectively mediate taste perception. Based on analysis of functional partners of human TAS2R41 (which shares homology with the Pongo pygmaeus variant), several potential interaction partners can be identified . These include:
TAS1R1 (Taste receptor type 1 member 1): A receptor involved in umami taste perception, with potential functional relationships to TAS2R41 in the broader context of taste sensation integration .
TAS1R2 (Taste receptor type 1 member 2): A component of the sweet taste receptor, potentially interacting with TAS2R41 in taste receptor cells .
TAS1R3 (Taste receptor type 1 member 3): A versatile taste receptor subunit involved in both umami and sweet taste perception, possibly sharing signaling components with TAS2R41 .
CASR (Extracellular calcium-sensing receptor): A G-protein-coupled receptor involved in calcium homeostasis, with potential functional relationships to taste reception pathways .
These interactions suggest that TAS2R41 operates within a complex network of taste receptors and signaling proteins, contributing to the integrated perception of diverse taste modalities.
TAS2R41 belongs to a larger family of taste receptors that collectively enable the perception of various taste modalities. While T2R receptors like TAS2R41 mediate bitter taste, T1R receptors are responsible for sweet and umami tastes . T1R receptors function as heteromeric complexes, with T1R1/T1R3 responding to umami stimuli (like monosodium glutamate) and T1R2/T1R3 recognizing diverse sweet compounds .
The structural and functional differences between these receptor families reflect their specialized roles in taste perception. T1R receptors, for instance, include specific domains like the N-terminal Venus flytrap domain, which is involved in ligand recognition, and transmembrane domains crucial for G-protein coupling . By comparison, T2R receptors like TAS2R41 have a different structural organization adapted to their specific function in detecting bitter compounds.
Within the T2R family itself, the TAS2R41 receptor represents one of multiple bitter taste receptors, each potentially specialized for detecting different bitter compounds. Another example from Pongo pygmaeus is TAS2R7, which likely has its own specific ligand preferences and signaling characteristics .
Recombinant Pongo pygmaeus TAS2R41 serves multiple purposes in scientific research:
Comparative evolutionary studies: By comparing TAS2R41 from orangutans with homologous receptors from other primates (including humans), researchers can investigate the evolution of taste perception across species.
Structure-function analysis: The recombinant protein enables detailed investigation of the relationship between receptor structure and ligand binding specificity.
Pharmacological screening: TAS2R41 can be used in high-throughput screening assays to identify compounds that activate or inhibit bitter taste perception, with potential applications in food science and pharmaceuticals.
Antibody production: The purified recombinant protein can serve as an antigen for generating specific antibodies against TAS2R41, which are valuable tools for immunological studies.
Expression studies: The recombinant protein provides a reference standard for studies investigating TAS2R41 expression levels in various tissues.
TAS2R41, like other TAS2R genes, is intronless and contains a single coding exon. In Pongo pygmaeus, TAS2R41 is likely located near telomeric regions as observed with other vertebrate TAS2R genes. The gene's chromosomal positioning is significant as TAS2R genes are typically found in clusters, with amphibian and mammalian species showing different clustering patterns . Research indicates that TAS2R genes located closer to telomeres have a higher chance of duplication (mean distance from telomere: 0.18 for clustered genes vs. 0.24 for singleton genes) . For Pongo pygmaeus TAS2R41, investigating its genomic context relative to other TAS2R genes can provide insights into its evolutionary history.
Recombinant expression typically utilizes heterologous systems like HEK293 cells with optimization for membrane protein expression. These systems may lack orangutan-specific chaperones or post-translational machinery, potentially affecting receptor folding and trafficking. For optimal recombinant expression of TAS2R41, modifications should include codon optimization for the expression system, addition of N-terminal tags (such as the first 45 amino acids of rat somatostatin receptor type 3), and co-expression with taste-specific G-proteins like gustducin or transducin . When comparing to native expression, consider that TAS2R receptors have been found in multiple tissues beyond the tongue, including brain, stomach, intestines, liver, and skin in various vertebrates .
Common challenges include:
Poor plasma membrane trafficking (solution: chimeric constructs with rhodopsin or 5-HT receptor N-termini)
Low expression levels (solution: codon optimization and temperature regulation)
Misfolding (solution: molecular chaperones and DMSO supplementation)
Lack of appropriate G-protein coupling (solution: co-transfection with Gα-gustducin or Gα-transducin)
Additionally, the proper reconstitution of downstream signaling components is critical, as TAS2R receptors typically signal through calcium mobilization pathways that must be accurately reproduced in heterologous systems .
Based on comparative studies across vertebrates, TAS2R receptors show expression beyond oral tissues. While orangutan-specific expression data is limited, research across vertebrates suggests TAS2R41 may be expressed in:
| Tissue | Relative Expression Level | Potential Function |
|---|---|---|
| Tongue | High | Traditional bitter taste perception |
| Brain | Moderate | Neuromodulation and chemosensing |
| Gastrointestinal tract | Moderate to High | Nutrient sensing and hormone release |
| Respiratory system | Low to Moderate | Pathogen and irritant detection |
| Skin | Low | Environmental chemical sensing |
Research in other vertebrates demonstrates that species with expanded TAS2R repertoires show greater extra-oral expression . Amphibians with higher TAS2R gene counts (e.g., bullfrog with 178 genes) show up to 45% of their TAS2R receptors expressed exclusively in extra-oral tissues . As a primate, Pongo pygmaeus likely follows mammalian patterns with significant gastrointestinal expression .
TAS2R41, like other TAS2R receptors, primarily couples to G-protein alpha subunits, particularly Gα-gustducin and Gα-transducin-2 (Gαt-2) . The signaling cascade typically involves:
Receptor activation upon ligand binding
G-protein dissociation and activation
Phospholipase C (PLC) activation
Inositol trisphosphate (IP3) generation
Calcium release from intracellular stores
Activation of TRPM5 channels
Membrane depolarization
For recombinant expression studies, functional assays should include calcium imaging techniques or FLIPR-based assays that can detect intracellular calcium flux upon receptor activation . Co-expression with appropriate G-proteins is essential for proper signaling reconstitution.
Based on comparative bitter receptor pharmacology, TAS2R41 likely responds to a subset of bitter compounds. A representative selectivity profile might include:
| Compound Class | Example Ligands | Activation Potency (EC50 range) | Specificity |
|---|---|---|---|
| Plant alkaloids | Quinine, strychnine | 10-100 μM | Moderate |
| Flavonoids | Naringin, hesperidin | 50-200 μM | Low-Moderate |
| Terpenoids | Limonin, cucurbitacins | 5-50 μM | High |
| Phenolic compounds | Salicin, arbutin | 100-500 μM | Low |
To experimentally determine the actual ligand profile, heterologous expression systems coupled with calcium imaging or reporter gene assays would be necessary. Comparison with other primate TAS2R41 orthologs could reveal evolutionary adaptations to specific ecological niches and dietary preferences .
For optimal expression in mammalian cell lines:
Expression Vector Selection:
Use vectors with strong CMV or EF1α promoters
Include Kozak sequence for efficient translation initiation
Consider inducible systems (tetracycline-regulated) for toxic proteins
Cell Line Selection:
HEK293T cells offer high transfection efficiency
HEK293F for suspension culture and larger-scale production
CHO cells for stable cell line generation
Expression Enhancement:
Culture at 30-32°C for 24-48 hours post-transfection
Add 10 mM sodium butyrate to enhance promoter activity
Supplement with 2% DMSO to improve folding
Co-expression Components:
Detection Modifications:
N-terminal addition of first 45 amino acids of rat somatostatin receptor type 3
C-terminal epitope tags (FLAG, V5, or HA) for detection
Fluorescent protein fusions at C-terminus for localization studies
Effective methods include:
Calcium Imaging Assays:
Fluo-4 AM or Fura-2 AM dye loading
Single-cell microscopy for detailed kinetic analysis
FLIPR-based plate reader assays for higher throughput
Optimal cell density: 50,000-75,000 cells/well in 96-well format
Reporter Gene Assays:
NFAT-responsive luciferase constructs (pGL4.30)
Incubation time: 4-6 hours post-stimulation
Supplement with probenecid (2.5 mM) to prevent dye leakage
IP3 Measurement:
Direct quantification using radiometric or ELISA-based assays
Early timepoint sampling (15-30 seconds post-stimulation)
Electrophysiology:
Whole-cell patch-clamp recording
Measurement of TRPM5-mediated currents
Enables precise temporal resolution of signaling
Conformational Biosensors:
Systematic troubleshooting approach:
Expression Verification:
Western blot analysis of whole-cell lysates and membrane fractions
Immunofluorescence microscopy to confirm plasma membrane localization
Flow cytometry to quantify surface expression if using epitope tags
Signaling Component Verification:
Western blot verification of G-protein expression
Positive control activation using compounds that directly activate G-proteins
cAMP or calcium assays using receptor-independent activators
Receptor Modifications:
Try alternative N-terminal tags (first 45 amino acids of rat somatostatin receptor type 3 is often effective)
Test different C-terminal epitope tags (some may interfere with G-protein coupling)
Generate chimeric receptors with well-expressed bitter receptors
Assay Optimization:
Adjust cell density and transfection efficiency
Optimize dye loading conditions (concentration, time, temperature)
Test response at different time points post-transfection (24, 48, 72 hours)
Ligand Preparation:
TAS2R receptors show dynamic evolutionary patterns with relatively few one-to-one orthologs between even closely related species . For Pongo pygmaeus TAS2R41:
Most closely related to other great ape TAS2R41 orthologs
Forms part of a larger TAS2R subfamily that emerged during primate evolution
May show evidence of positive selection in ligand-binding regions
Evolutionary analysis of TAS2R genes across vertebrates reveals that while gene count remains relatively stable within lineages, specific receptors often evolve rapidly . For primates, this suggests adaptive evolution in response to dietary specialization and toxin detection abilities. Orangutans, with their specialized frugivorous diet in Southeast Asian forests, may show unique adaptations in their TAS2R41 receptor compared to other great apes.
Several selective pressures likely influenced TAS2R41 evolution:
Dietary Adaptation:
Orangutans consume over 400 plant species including many with bitter compounds
Selection for detection of specific fruit toxins in their native habitats
Potential relaxed selection on certain bitter detection pathways due to specialized diet
Genomic Location Effects:
Ecological Factors:
Plant secondary compound adaptation specific to Borneo and Sumatra
Co-evolution with dietary plants containing specific bitter compounds
Functional adaptation to detect specific toxins relevant to orangutan ecology
Statistical evidence from studies of TAS2R evolution across vertebrates indicates shifts in selective regimes, with Ornstein-Uhlenbeck (OU) models with multiple regime shifts fitting the data better than Brownian Motion models, supporting a role for selection in TAS2R gene content evolution .
Key genomic events include:
Gene Duplication:
Tandem duplication events facilitated by chromosomal positioning
Whole genome duplication events early in vertebrate evolution
Subsequent subfunctionalization allowing specialized detection roles
Recombination Patterns:
Sequence Diversification:
Positive selection on ligand-binding regions
Conserved G-protein coupling domains
Variable selective pressures across primate lineages
For Pongo pygmaeus specifically, research on TAS2R genetic composition in great apes suggests lineage-specific adaptations related to their distinct ecological niches and feeding behaviors.
TAS2R41 offers several research opportunities:
Ancestral Sequence Reconstruction:
Resurrect ancestral TAS2R41 from key nodes in primate evolution
Compare functional properties with modern orthologs
Map critical mutations that altered ligand specificity
Ecological Correlation Studies:
Correlate TAS2R41 sequence variations with dietary preferences
Analyze ecological adaptation across orangutan subspecies
Identify parallel adaptations in distantly related species
Structure-Function Analysis:
Model binding pocket differences between species
Perform site-directed mutagenesis of key residues
Characterize changes in ligand specificity profiles
Comparative Expression Analysis:
Based on studies of TAS2Rs in other vertebrates, TAS2R41 may serve several extra-oral functions:
Gastrointestinal Tract:
Respiratory System:
Detection of bacterial compounds
Triggering protective responses (increased mucus, ciliary beating)
Bronchodilation/constriction in response to environmental irritants
Brain:
Neuromodulation
Involvement in innate avoidance behaviors
Potential roles in neuronal development
Skin:
Environmental chemical sensing
Toxin detection and protective responses
Immunomodulatory functions
Research across vertebrate species shows that species with expanded TAS2R repertoires exhibit more extra-oral expression . As research on amphibians demonstrates, approximately 45% of TAS2R receptors in species with large TAS2R repertoires are expressed exclusively in extra-oral tissues .
Cross-species functional analysis provides several insights:
Ligand Specificity Comparison:
Test identical compounds across TAS2R41 orthologs from different primates
Correlate differences with dietary specializations
Identify convergent adaptations in distantly related species
Receptor Sensitivity Analysis:
Compare EC50 values for shared ligands across species
Identify threshold differences that correlate with ecological exposure
Map adaptive mutations driving sensitivity shifts
Experimental Approaches:
Heterologous expression of multiple TAS2R41 orthologs
Chimeric receptor construction to isolate functional domains
High-throughput screening against ecologically relevant compound libraries
Ecological Correlation:
Compare receptor properties with known dietary patterns
Analyze plant compound distribution in native habitats
Test behavioral responses to receptor-specific ligands
Data Analysis Framework:
Promising future directions include:
Comprehensive Ligand Profiling:
Screen against libraries of natural compounds from orangutan habitats
Determine structure-activity relationships for potent ligands
Develop selective agonists and antagonists as research tools
In vivo Functional Studies:
Develop organoid models expressing native TAS2R41
Investigate tissue-specific roles through conditional expression
Study the receptor's role in behavioral responses to bitter compounds
Ecological Genomics:
Analyze TAS2R41 variation across orangutan populations
Correlate with local dietary adaptations
Study endangered population genomic patterns to inform conservation
Translational Applications:
Develop TAS2R41-based biosensors for environmental toxin detection
Explore potential roles in chemical ecology research
Investigate applications in primate conservation biology
Research on TAS2R evolution in vertebrates provides a framework for understanding how these receptors adapt to ecological niches and expand their functional repertoire beyond taste perception .
Key methodological advances include:
Structural Biology:
Cryo-EM structures of TAS2R41 with various ligands
Improved computational modeling of membrane protein dynamics
Advanced binding pocket prediction algorithms
Single-Cell Technologies:
Single-cell RNA-seq of taste and extra-oral tissues
Spatial transcriptomics to map receptor expression patterns
Cell-specific proteomics to identify interacting partners
Functional Genomics:
CRISPR-based screening for downstream signaling components
Massively parallel reporter assays for regulatory element identification
Systematic mutagenesis to develop structure-function maps
Advanced Imaging:
Super-resolution microscopy of receptor trafficking
Label-free detection of conformational changes
In vivo calcium imaging in model organisms
Artificial Intelligence: