Recombinant Pongo pygmaeus Taste receptor type 2 member 41 (TAS2R41)

Shipped with Ice Packs
In Stock

Description

Introduction to TAS2R41

Taste receptor type 2 member 41 (TAS2R41) belongs to the T2R family of G-protein coupled receptors specifically responsible for the detection of bitter compounds. In Pongo pygmaeus (Bornean orangutan), this receptor plays a crucial role in the gustatory system, allowing these primates to detect potentially harmful substances through bitter taste perception. TAS2R41 functions as a gustducin-linked receptor, potentially involved not only in oral taste perception but also in sensing the chemical composition of gastrointestinal contents . The recombinant form of this protein enables detailed scientific investigation into its structure-function relationships and comparative analysis with homologous receptors in other species.

Protein Structure

TAS2R41 is classified as a member of the G-protein coupled receptor (GPCR) T2R family. Similar to other proteins in this family, it likely contains seven transmembrane domains characteristic of GPCRs, with intracellular and extracellular loops connecting these domains. The full-length protein consists of 307 amino acids, forming a complex three-dimensional structure embedded in the cell membrane . While the precise three-dimensional structure of Pongo pygmaeus TAS2R41 has not been fully elucidated in the available literature, its membership in the T2R family suggests structural homology with other bitter taste receptors.

Amino Acid Sequence

The complete amino acid sequence of Pongo pygmaeus TAS2R41 is:

MQAALTATFFMLFFSLSLGIAANGFIVLVLGREWLQYGRLLPLDMILISLGVSRFCLQLVGTVYNFYYSAHKVEYSGGLSRQFFHLHWHFLNLATFXFCSWLSVLFCVKXANITHPTFLWLKWRFPGWVPWLLLGSVLISFIITLLLFWVNYPVYQEFLIRKFSGNMTYEWNTRIEMYYLPSLKLVIWSIPCSVFLVSIMLLINSLRRHTWTRMQHNGHSLQDPSTQAHTRAXKSLISFFILYVLSFLSLIIDATKFISMQNDFYWPWQTAVYLGVSVHPFILIFSNLKLRSVFWKLLLLARGFWVA

This sequence contains several notable features, including hydrophobic regions corresponding to transmembrane domains and potential binding sites for bitter compounds. The presence of 'X' characters in the sequence indicates positions where amino acid identity could not be unambiguously determined in the original sequencing.

Gene Information

The gene encoding TAS2R41 in Pongo pygmaeus is designated as TAS2R41. The recombinant protein is cataloged in the UniProt database with the accession number Q645U6, providing a standardized reference for this specific protein . The expression region of the protein spans positions 1-307, indicating that the recombinant form represents the full-length native protein rather than a truncated version .

Role in Taste Perception

TAS2R41 primarily functions in bitter taste perception, a critical sensory mechanism that helps organisms detect potentially harmful substances. As a bitter taste receptor, TAS2R41 likely responds to specific bitter compounds, though the exact ligand specificity for the Pongo pygmaeus variant is not extensively documented in the available literature. By comparison with other T2R family members, it potentially contributes to the orangutan's ability to discriminate between various bitter compounds in their diet, which may include plant alkaloids and other potentially toxic substances .

Signaling Mechanisms

The activity of TAS2R41 involves several downstream signaling components. Upon activation by bitter compounds, TAS2R41 likely stimulates alpha gustducin (a G-protein subunit specific to taste receptor cells), which then mediates the activation of phospholipase C-beta-2 (PLC-β2) . This cascade ultimately leads to the gating of transient receptor potential cation channel subfamily M member 5 (TRPM5), resulting in membrane depolarization and neurotransmitter release from taste cells . This signaling pathway represents the molecular basis for bitter taste sensation and is conserved across various species, though specific adaptations may exist in Pongo pygmaeus.

Production and Characteristics

The recombinant Pongo pygmaeus TAS2R41 protein is commercially available as a research reagent. It is typically supplied at a quantity of 50 μg, though other quantities may also be available depending on the supplier . The production process involves recombinant DNA technology, whereby the TAS2R41 gene is expressed in a suitable host system to generate the functional protein. The tag type used for purification and detection is determined during the production process and may vary between different preparations .

The recombinant protein is provided in a storage buffer consisting of Tris-based buffer with 50% glycerol, optimized specifically for this protein to maintain its stability and activity . This formulation helps preserve the native conformation and functional properties of the protein during storage and handling.

Protein Interactions and Partners

TAS2R41 functions within a network of interacting proteins that collectively mediate taste perception. Based on analysis of functional partners of human TAS2R41 (which shares homology with the Pongo pygmaeus variant), several potential interaction partners can be identified . These include:

  1. TAS1R1 (Taste receptor type 1 member 1): A receptor involved in umami taste perception, with potential functional relationships to TAS2R41 in the broader context of taste sensation integration .

  2. TAS1R2 (Taste receptor type 1 member 2): A component of the sweet taste receptor, potentially interacting with TAS2R41 in taste receptor cells .

  3. TAS1R3 (Taste receptor type 1 member 3): A versatile taste receptor subunit involved in both umami and sweet taste perception, possibly sharing signaling components with TAS2R41 .

  4. CASR (Extracellular calcium-sensing receptor): A G-protein-coupled receptor involved in calcium homeostasis, with potential functional relationships to taste reception pathways .

These interactions suggest that TAS2R41 operates within a complex network of taste receptors and signaling proteins, contributing to the integrated perception of diverse taste modalities.

Comparative Analysis with Other Taste Receptors

TAS2R41 belongs to a larger family of taste receptors that collectively enable the perception of various taste modalities. While T2R receptors like TAS2R41 mediate bitter taste, T1R receptors are responsible for sweet and umami tastes . T1R receptors function as heteromeric complexes, with T1R1/T1R3 responding to umami stimuli (like monosodium glutamate) and T1R2/T1R3 recognizing diverse sweet compounds .

The structural and functional differences between these receptor families reflect their specialized roles in taste perception. T1R receptors, for instance, include specific domains like the N-terminal Venus flytrap domain, which is involved in ligand recognition, and transmembrane domains crucial for G-protein coupling . By comparison, T2R receptors like TAS2R41 have a different structural organization adapted to their specific function in detecting bitter compounds.

Within the T2R family itself, the TAS2R41 receptor represents one of multiple bitter taste receptors, each potentially specialized for detecting different bitter compounds. Another example from Pongo pygmaeus is TAS2R7, which likely has its own specific ligand preferences and signaling characteristics .

Applications in Research

Recombinant Pongo pygmaeus TAS2R41 serves multiple purposes in scientific research:

  1. Comparative evolutionary studies: By comparing TAS2R41 from orangutans with homologous receptors from other primates (including humans), researchers can investigate the evolution of taste perception across species.

  2. Structure-function analysis: The recombinant protein enables detailed investigation of the relationship between receptor structure and ligand binding specificity.

  3. Pharmacological screening: TAS2R41 can be used in high-throughput screening assays to identify compounds that activate or inhibit bitter taste perception, with potential applications in food science and pharmaceuticals.

  4. Antibody production: The purified recombinant protein can serve as an antigen for generating specific antibodies against TAS2R41, which are valuable tools for immunological studies.

  5. Expression studies: The recombinant protein provides a reference standard for studies investigating TAS2R41 expression levels in various tissues.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage condition, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R41; Taste receptor type 2 member 41; T2R41
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Pongo pygmaeus (Bornean orangutan)
Target Names
Target Protein Sequence
MQAALTAFFMLFFSLLSLLGIAANGFIVLVLGREWLQYGRLLPLDMILISLGVSRFCLQL VGTVYNFYYSAHKVEYSGGLSRQFFHLHWHFLNLATFXFCSWLSVLFCVKXANITHPTFL WLKWRFPGWVPWLLLGSVLISFIITLLLFWVNYPVYQEFLIRKFSGNMTYEWNTRIEMYY LPSLKLVIWSIPCSVFLVSIMLLINSLRRHTWRMQHNGHSLQDPSTQAHTRAXKSLISFL ILYVLSFLSLIIDATKFISMQNDFYWPWQTAVYLGVSVHPFILIFSNLKLRSVFWKLLLL ARGFWVA
Uniprot No.

Target Background

Function
This receptor plays a potential role in the perception of bitterness and is linked to gustducin. It might be involved in sensing the chemical composition of the gastrointestinal content. The activation of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to the gating of TRPM5.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic structure of Pongo pygmaeus TAS2R41?

TAS2R41, like other TAS2R genes, is intronless and contains a single coding exon. In Pongo pygmaeus, TAS2R41 is likely located near telomeric regions as observed with other vertebrate TAS2R genes. The gene's chromosomal positioning is significant as TAS2R genes are typically found in clusters, with amphibian and mammalian species showing different clustering patterns . Research indicates that TAS2R genes located closer to telomeres have a higher chance of duplication (mean distance from telomere: 0.18 for clustered genes vs. 0.24 for singleton genes) . For Pongo pygmaeus TAS2R41, investigating its genomic context relative to other TAS2R genes can provide insights into its evolutionary history.

How does recombinant expression of TAS2R41 differ from native expression?

Recombinant expression typically utilizes heterologous systems like HEK293 cells with optimization for membrane protein expression. These systems may lack orangutan-specific chaperones or post-translational machinery, potentially affecting receptor folding and trafficking. For optimal recombinant expression of TAS2R41, modifications should include codon optimization for the expression system, addition of N-terminal tags (such as the first 45 amino acids of rat somatostatin receptor type 3), and co-expression with taste-specific G-proteins like gustducin or transducin . When comparing to native expression, consider that TAS2R receptors have been found in multiple tissues beyond the tongue, including brain, stomach, intestines, liver, and skin in various vertebrates .

What are the common challenges in generating functional recombinant TAS2R41?

Common challenges include:

  • Poor plasma membrane trafficking (solution: chimeric constructs with rhodopsin or 5-HT receptor N-termini)

  • Low expression levels (solution: codon optimization and temperature regulation)

  • Misfolding (solution: molecular chaperones and DMSO supplementation)

  • Lack of appropriate G-protein coupling (solution: co-transfection with Gα-gustducin or Gα-transducin)

Additionally, the proper reconstitution of downstream signaling components is critical, as TAS2R receptors typically signal through calcium mobilization pathways that must be accurately reproduced in heterologous systems .

What tissues express TAS2R41 in Pongo pygmaeus beyond the oral cavity?

Based on comparative studies across vertebrates, TAS2R receptors show expression beyond oral tissues. While orangutan-specific expression data is limited, research across vertebrates suggests TAS2R41 may be expressed in:

TissueRelative Expression LevelPotential Function
TongueHighTraditional bitter taste perception
BrainModerateNeuromodulation and chemosensing
Gastrointestinal tractModerate to HighNutrient sensing and hormone release
Respiratory systemLow to ModeratePathogen and irritant detection
SkinLowEnvironmental chemical sensing

Research in other vertebrates demonstrates that species with expanded TAS2R repertoires show greater extra-oral expression . Amphibians with higher TAS2R gene counts (e.g., bullfrog with 178 genes) show up to 45% of their TAS2R receptors expressed exclusively in extra-oral tissues . As a primate, Pongo pygmaeus likely follows mammalian patterns with significant gastrointestinal expression .

How does TAS2R41 couple to intracellular signaling pathways?

TAS2R41, like other TAS2R receptors, primarily couples to G-protein alpha subunits, particularly Gα-gustducin and Gα-transducin-2 (Gαt-2) . The signaling cascade typically involves:

  • Receptor activation upon ligand binding

  • G-protein dissociation and activation

  • Phospholipase C (PLC) activation

  • Inositol trisphosphate (IP3) generation

  • Calcium release from intracellular stores

  • Activation of TRPM5 channels

  • Membrane depolarization

For recombinant expression studies, functional assays should include calcium imaging techniques or FLIPR-based assays that can detect intracellular calcium flux upon receptor activation . Co-expression with appropriate G-proteins is essential for proper signaling reconstitution.

What is the ligand selectivity profile of Pongo pygmaeus TAS2R41?

Based on comparative bitter receptor pharmacology, TAS2R41 likely responds to a subset of bitter compounds. A representative selectivity profile might include:

Compound ClassExample LigandsActivation Potency (EC50 range)Specificity
Plant alkaloidsQuinine, strychnine10-100 μMModerate
FlavonoidsNaringin, hesperidin50-200 μMLow-Moderate
TerpenoidsLimonin, cucurbitacins5-50 μMHigh
Phenolic compoundsSalicin, arbutin100-500 μMLow

To experimentally determine the actual ligand profile, heterologous expression systems coupled with calcium imaging or reporter gene assays would be necessary. Comparison with other primate TAS2R41 orthologs could reveal evolutionary adaptations to specific ecological niches and dietary preferences .

What are the optimal conditions for recombinant expression of TAS2R41 in mammalian cell lines?

For optimal expression in mammalian cell lines:

  • Expression Vector Selection:

    • Use vectors with strong CMV or EF1α promoters

    • Include Kozak sequence for efficient translation initiation

    • Consider inducible systems (tetracycline-regulated) for toxic proteins

  • Cell Line Selection:

    • HEK293T cells offer high transfection efficiency

    • HEK293F for suspension culture and larger-scale production

    • CHO cells for stable cell line generation

  • Expression Enhancement:

    • Culture at 30-32°C for 24-48 hours post-transfection

    • Add 10 mM sodium butyrate to enhance promoter activity

    • Supplement with 2% DMSO to improve folding

  • Co-expression Components:

    • Gα16gust44 (chimeric G-protein) for robust coupling

    • RTP3/RTP4 (receptor transporting proteins) for improved trafficking

    • REEP1 (receptor expression enhancing protein) for membrane insertion

  • Detection Modifications:

    • N-terminal addition of first 45 amino acids of rat somatostatin receptor type 3

    • C-terminal epitope tags (FLAG, V5, or HA) for detection

    • Fluorescent protein fusions at C-terminus for localization studies

What methods are most effective for detecting ligand-induced activation of TAS2R41?

Effective methods include:

  • Calcium Imaging Assays:

    • Fluo-4 AM or Fura-2 AM dye loading

    • Single-cell microscopy for detailed kinetic analysis

    • FLIPR-based plate reader assays for higher throughput

    • Optimal cell density: 50,000-75,000 cells/well in 96-well format

  • Reporter Gene Assays:

    • NFAT-responsive luciferase constructs (pGL4.30)

    • Incubation time: 4-6 hours post-stimulation

    • Supplement with probenecid (2.5 mM) to prevent dye leakage

  • IP3 Measurement:

    • Direct quantification using radiometric or ELISA-based assays

    • Early timepoint sampling (15-30 seconds post-stimulation)

  • Electrophysiology:

    • Whole-cell patch-clamp recording

    • Measurement of TRPM5-mediated currents

    • Enables precise temporal resolution of signaling

  • Conformational Biosensors:

    • BRET or FRET-based sensors incorporating TAS2R41

    • Real-time monitoring of conformational changes

    • Lower background compared to calcium assays

How can I troubleshoot non-responsive recombinant TAS2R41 in functional assays?

Systematic troubleshooting approach:

  • Expression Verification:

    • Western blot analysis of whole-cell lysates and membrane fractions

    • Immunofluorescence microscopy to confirm plasma membrane localization

    • Flow cytometry to quantify surface expression if using epitope tags

  • Signaling Component Verification:

    • Western blot verification of G-protein expression

    • Positive control activation using compounds that directly activate G-proteins

    • cAMP or calcium assays using receptor-independent activators

  • Receptor Modifications:

    • Try alternative N-terminal tags (first 45 amino acids of rat somatostatin receptor type 3 is often effective)

    • Test different C-terminal epitope tags (some may interfere with G-protein coupling)

    • Generate chimeric receptors with well-expressed bitter receptors

  • Assay Optimization:

    • Adjust cell density and transfection efficiency

    • Optimize dye loading conditions (concentration, time, temperature)

    • Test response at different time points post-transfection (24, 48, 72 hours)

  • Ligand Preparation:

    • Ensure ligand solubility in assay buffer

    • Prepare fresh solutions to avoid degradation

    • Test across wider concentration ranges (nM to high μM)

How does Pongo pygmaeus TAS2R41 compare phylogenetically to other primate TAS2R receptors?

TAS2R receptors show dynamic evolutionary patterns with relatively few one-to-one orthologs between even closely related species . For Pongo pygmaeus TAS2R41:

  • Most closely related to other great ape TAS2R41 orthologs

  • Forms part of a larger TAS2R subfamily that emerged during primate evolution

  • May show evidence of positive selection in ligand-binding regions

Evolutionary analysis of TAS2R genes across vertebrates reveals that while gene count remains relatively stable within lineages, specific receptors often evolve rapidly . For primates, this suggests adaptive evolution in response to dietary specialization and toxin detection abilities. Orangutans, with their specialized frugivorous diet in Southeast Asian forests, may show unique adaptations in their TAS2R41 receptor compared to other great apes.

What selective pressures have shaped the evolution of TAS2R41 in orangutans?

Several selective pressures likely influenced TAS2R41 evolution:

  • Dietary Adaptation:

    • Orangutans consume over 400 plant species including many with bitter compounds

    • Selection for detection of specific fruit toxins in their native habitats

    • Potential relaxed selection on certain bitter detection pathways due to specialized diet

  • Genomic Location Effects:

    • TAS2R genes closer to telomeres show higher recombination rates

    • Clustered TAS2R genes show evidence of both rapid turnover and conservation

    • Analysis of orthologous TAS2R loci shows some clusters persisting for over 350 million years

  • Ecological Factors:

    • Plant secondary compound adaptation specific to Borneo and Sumatra

    • Co-evolution with dietary plants containing specific bitter compounds

    • Functional adaptation to detect specific toxins relevant to orangutan ecology

Statistical evidence from studies of TAS2R evolution across vertebrates indicates shifts in selective regimes, with Ornstein-Uhlenbeck (OU) models with multiple regime shifts fitting the data better than Brownian Motion models, supporting a role for selection in TAS2R gene content evolution .

What genomic events have contributed to TAS2R41 evolution in primates?

Key genomic events include:

  • Gene Duplication:

    • Tandem duplication events facilitated by chromosomal positioning

    • Whole genome duplication events early in vertebrate evolution

    • Subsequent subfunctionalization allowing specialized detection roles

  • Recombination Patterns:

    • Enhanced recombination near telomeres where many TAS2R genes locate

    • Lower recombination rates for some conserved TAS2R clusters

    • Varying roles of repeat elements in different lineages

  • Sequence Diversification:

    • Positive selection on ligand-binding regions

    • Conserved G-protein coupling domains

    • Variable selective pressures across primate lineages

For Pongo pygmaeus specifically, research on TAS2R genetic composition in great apes suggests lineage-specific adaptations related to their distinct ecological niches and feeding behaviors.

How can TAS2R41 be utilized in studying the molecular basis of taste perception evolution?

TAS2R41 offers several research opportunities:

  • Ancestral Sequence Reconstruction:

    • Resurrect ancestral TAS2R41 from key nodes in primate evolution

    • Compare functional properties with modern orthologs

    • Map critical mutations that altered ligand specificity

  • Ecological Correlation Studies:

    • Correlate TAS2R41 sequence variations with dietary preferences

    • Analyze ecological adaptation across orangutan subspecies

    • Identify parallel adaptations in distantly related species

  • Structure-Function Analysis:

    • Model binding pocket differences between species

    • Perform site-directed mutagenesis of key residues

    • Characterize changes in ligand specificity profiles

  • Comparative Expression Analysis:

    • Quantify expression across tissues in different primate species

    • Correlate extra-oral expression with physiological functions

    • Identify regulatory elements driving expression patterns

What role might TAS2R41 play in extra-oral tissues of orangutans?

Based on studies of TAS2Rs in other vertebrates, TAS2R41 may serve several extra-oral functions:

  • Gastrointestinal Tract:

    • Nutrient chemosensing in enteroendocrine cells

    • Regulation of gut hormone release (CCK, GLP-1)

    • Modulation of glucose absorption

    • Initiation of emetic responses to toxins

  • Respiratory System:

    • Detection of bacterial compounds

    • Triggering protective responses (increased mucus, ciliary beating)

    • Bronchodilation/constriction in response to environmental irritants

  • Brain:

    • Neuromodulation

    • Involvement in innate avoidance behaviors

    • Potential roles in neuronal development

  • Skin:

    • Environmental chemical sensing

    • Toxin detection and protective responses

    • Immunomodulatory functions

Research across vertebrate species shows that species with expanded TAS2R repertoires exhibit more extra-oral expression . As research on amphibians demonstrates, approximately 45% of TAS2R receptors in species with large TAS2R repertoires are expressed exclusively in extra-oral tissues .

How can cross-species functional analysis of TAS2R41 inform our understanding of dietary adaptation?

Cross-species functional analysis provides several insights:

  • Ligand Specificity Comparison:

    • Test identical compounds across TAS2R41 orthologs from different primates

    • Correlate differences with dietary specializations

    • Identify convergent adaptations in distantly related species

  • Receptor Sensitivity Analysis:

    • Compare EC50 values for shared ligands across species

    • Identify threshold differences that correlate with ecological exposure

    • Map adaptive mutations driving sensitivity shifts

  • Experimental Approaches:

    • Heterologous expression of multiple TAS2R41 orthologs

    • Chimeric receptor construction to isolate functional domains

    • High-throughput screening against ecologically relevant compound libraries

  • Ecological Correlation:

    • Compare receptor properties with known dietary patterns

    • Analyze plant compound distribution in native habitats

    • Test behavioral responses to receptor-specific ligands

  • Data Analysis Framework:

    • Phylogenetic comparative methods to control for shared ancestry

    • Molecular evolutionary analyses to detect selection signatures

    • Statistical modeling of structure-function relationships

What are the most promising future research directions for Pongo pygmaeus TAS2R41?

Promising future directions include:

  • Comprehensive Ligand Profiling:

    • Screen against libraries of natural compounds from orangutan habitats

    • Determine structure-activity relationships for potent ligands

    • Develop selective agonists and antagonists as research tools

  • In vivo Functional Studies:

    • Develop organoid models expressing native TAS2R41

    • Investigate tissue-specific roles through conditional expression

    • Study the receptor's role in behavioral responses to bitter compounds

  • Ecological Genomics:

    • Analyze TAS2R41 variation across orangutan populations

    • Correlate with local dietary adaptations

    • Study endangered population genomic patterns to inform conservation

  • Translational Applications:

    • Develop TAS2R41-based biosensors for environmental toxin detection

    • Explore potential roles in chemical ecology research

    • Investigate applications in primate conservation biology

Research on TAS2R evolution in vertebrates provides a framework for understanding how these receptors adapt to ecological niches and expand their functional repertoire beyond taste perception .

What methodological advances would most benefit TAS2R41 research?

Key methodological advances include:

  • Structural Biology:

    • Cryo-EM structures of TAS2R41 with various ligands

    • Improved computational modeling of membrane protein dynamics

    • Advanced binding pocket prediction algorithms

  • Single-Cell Technologies:

    • Single-cell RNA-seq of taste and extra-oral tissues

    • Spatial transcriptomics to map receptor expression patterns

    • Cell-specific proteomics to identify interacting partners

  • Functional Genomics:

    • CRISPR-based screening for downstream signaling components

    • Massively parallel reporter assays for regulatory element identification

    • Systematic mutagenesis to develop structure-function maps

  • Advanced Imaging:

    • Super-resolution microscopy of receptor trafficking

    • Label-free detection of conformational changes

    • In vivo calcium imaging in model organisms

  • Artificial Intelligence:

    • Machine learning for ligand prediction

    • Network analysis of bitter taste signaling pathways

    • Evolutionary trajectory modeling using phylogenetic approaches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.