Recombinant Pongo pygmaeus Taste receptor type 2 member 7 (TAS2R7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize developing it accordingly.
Synonyms
TAS2R7; Taste receptor type 2 member 7; T2R7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Pongo pygmaeus (Bornean orangutan)
Target Names
Target Protein Sequence
MTDKVQTTLLFLAVGEFSVGILGNAFIGLVNCMDWIKKRKIASIDLILTSLAISRICLLC VILLDCFILVLYPDVYATGKEMRIIDFFWILTNHLSIWFATCLSIYYFFKIANFFHPLFL WMKWRIDRVISWILLGCMVLSVFISLPATENLNADFRFCVKAKRKTNLTWSCRVNKTQHA SIKLLLNLATLLPFCVCLMSFFLLILSLRRHIRRMQLSATGCRDPSTEAHVRALKAVISF LLLFIAYYLSFLIATSSYFMPETELAVIFGESIALIYPSSHSFILILGNNKLRHASLKVI WKVMSILKGRKFQQHKQI
Uniprot No.

Target Background

Function
Gustducin-coupled receptor involved in the detection of bitter compounds in the oral cavity and the gastrointestinal tract. It signals through PLCB2 and the calcium-regulated cation channel TRPM5.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TAS2R7 and what is its role in Pongo pygmaeus?

TAS2R7 (Taste Receptor Type 2 Member 7) is a G-protein coupled receptor (GPCR) that functions as a bitter taste receptor. In Pongo pygmaeus, as in humans, it likely plays a crucial role in the detection of bitter compounds and potentially metallic ions. Based on human TAS2R7 research, this receptor is expressed in subsets of taste receptor cells of the tongue and in extraoral tissues, where it may function as a sensor for biologically relevant compounds . In orangutans, which are primarily frugivorous but consume a diverse diet including some potentially bitter plants, this receptor likely aids in avoiding toxic substances.

How does the structure of Pongo pygmaeus TAS2R7 compare to human TAS2R7?

While the specific structure of Pongo pygmaeus TAS2R7 has not been fully characterized in the available research, comparative analysis suggests similarities to human TAS2R7. Human TAS2R7 is characterized by a 7-transmembrane structure with conserved short N- and C-terminal domains . The human version comprises 318 amino acids with a molecular weight of approximately 36.5 kDa . When studying the orangutan variant, researchers typically use homology modeling similar to what has been done for the human receptor, which was modeled based on the crystal structure of the 5-HT2C serotonin receptor . Sequence alignment and phylogenetic analysis between human and orangutan TAS2R7 would reveal conservation of key functional residues, particularly those involved in ligand binding.

What expression systems are most effective for producing recombinant Pongo pygmaeus TAS2R7?

For recombinant expression of bitter taste receptors like TAS2R7, heterologous expression systems such as HEK293 cells are frequently employed. These cells provide appropriate post-translational modification capabilities while lacking endogenous taste receptors that could interfere with functional assays. When expressing Pongo pygmaeus TAS2R7, researchers should consider using codon-optimized synthetic genes for mammalian expression and incorporate N-terminal tags (such as FLAG or Rho tags) to enhance surface expression. Additionally, co-expression with chaperone proteins or using inducible expression systems may improve receptor folding and trafficking to the cell membrane. For functional studies, co-expression with chimeric G proteins (such as Gα16gust44) that couple to the calcium signaling pathway facilitates downstream readout in fluorometric or luminometric assays .

What are the optimal assay conditions for evaluating recombinant Pongo pygmaeus TAS2R7 activation by metal ions?

Based on research with human TAS2R7, calcium mobilization assays represent the gold standard for evaluating TAS2R7 activation. When studying metal ion interactions with Pongo pygmaeus TAS2R7, researchers should consider both calcium-containing and calcium-free assay solutions to accurately measure receptor responses. As observed with human TAS2R7, the presence of calcium (2 mM) in assay solutions may affect response amplitude without significantly altering EC50 values .

For optimal conditions, prepare two different assay solutions:

  • Standard calcium-containing solution: 130 mM NaCl, 5 mM KCl, 2 mM CaCl2, and 10 mM glucose (pH 7.4)

  • Calcium-free solution: 130 mM NaCl, 5 mM KCl, and 10 mM glucose (pH 7.4)

When testing metal ion responses, use concentration ranges that encompass physiologically relevant levels:

  • Zinc: 0.1-10 mM

  • Calcium: 1-20 mM

  • Magnesium: 1-20 mM

  • Copper: 0.1-5 mM

  • Manganese: 1-20 mM

  • Aluminum: 0.01-1 mM

Incorporate appropriate controls, including mock-transfected cells and known activators such as cromolyn (at concentrations of 1-10 mM) .

What mutagenesis strategies can identify critical residues for metal ion binding in Pongo pygmaeus TAS2R7?

To identify critical residues involved in metal ion binding, researchers should employ site-directed mutagenesis targeting conserved negatively charged residues, which typically interact with positively charged metal ions. Based on human TAS2R7 studies, attention should focus on residues equivalent to human H94 (position 3.37) and E264 (position 7.32), which have been implicated in metallic ion interaction .

Recommended mutagenesis approach:

  • Perform sequence alignment between human and Pongo pygmaeus TAS2R7 to identify conserved negatively charged residues

  • Generate single-point mutants replacing key glutamate, aspartate, and histidine residues with alanine or neutral amino acids

  • Assess the functional consequences of these mutations using calcium mobilization assays with various metal ions

  • For residues showing significant effects, create more subtle mutations (e.g., E→D, H→N) to evaluate the importance of side chain length versus charge

Construct validation should employ Western blotting and immunofluorescence to confirm expression levels and membrane localization of mutant receptors, ensuring that functional changes reflect altered binding rather than expression defects .

How can molecular dynamics simulations enhance understanding of Pongo pygmaeus TAS2R7 interactions with ligands?

Molecular dynamics (MD) simulations offer powerful insights into the dynamic interactions between TAS2R7 and its ligands. For Pongo pygmaeus TAS2R7, a comprehensive approach would include:

  • Homology modeling based on crystal structures of related GPCRs (as done for human TAS2R7 using the 5-HT2C serotonin receptor structure)

  • Model refinement through energy minimization using force fields such as AMBER ff14SB

  • Validation of model quality using PROCHECK or similar tools

  • Calculation of electrostatic potential using APBS to identify negatively charged regions suitable for cation binding

  • Docking simulations for larger ligands like cromolyn

  • Manual or semi-automated docking of metal ions followed by energy minimization

  • Long-timescale (>100 ns) MD simulations in explicit lipid bilayers

For metal ion interactions specifically, employ specialized force fields that accurately represent ion coordination geometry. The above approach would enable visualization of:

  • Conformational changes upon ligand binding

  • Water-mediated interactions in the binding pocket

  • Allosteric effects that propagate through the receptor structure

  • Interactions with intracellular signaling proteins

These simulations can generate testable hypotheses about species-specific differences in receptor function between human and orangutan TAS2R7 .

How does the ligand specificity of Pongo pygmaeus TAS2R7 compare to that of other primates?

Comparative analysis of TAS2R7 across primates provides insights into dietary adaptations and evolutionary selective pressures. While specific data on Pongo pygmaeus TAS2R7 ligand specificity is limited, evidence from human TAS2R7 suggests it is a narrowly tuned receptor responsive to certain bitter compounds (notably cromolyn at high concentrations) and various metal ions .

Researchers investigating Pongo pygmaeus TAS2R7 should consider:

  • Testing the receptor against a standardized bitter compound library including:

    • Plant alkaloids (quinine, strychnine)

    • Metal salts (ZnSO4, CuSO4, CaCl2, MgCl2, MnCl2, Al2(SO4)3)

    • Synthetic bitter compounds (denatonium, PROP, PTC)

    • Pharmaceuticals (diphenidol, chlorphenamine)

  • Comparing EC50 values across species using identical assay conditions

  • Correlating observed differences with:

    • Habitat-specific dietary compounds

    • Potential toxins encountered in the orangutan's natural environment

    • Ecological niche specialization

Based on human TAS2R7 data, particular attention should be paid to the receptor's response to metal ions, with special focus on concentration-response relationships and potential differences in efficacy or potency between human and orangutan receptors .

What are the key differences in TAS2R7 function between semi-solitary orangutans and more social great apes?

The social structure of orangutans differs markedly from other great apes, with Pongo pygmaeus being characterized as semi-solitary, forming only temporary social parties . This ecological and behavioral difference may correlate with variations in sensory perception systems, including taste receptor function.

When comparing TAS2R7 across great apes with different social structures, researchers should investigate:

  • Sequence divergence rates in binding pocket residues versus structural regions

  • Sensitivity differences to compounds found in orangutan-specific diet items

  • Potential co-evolution with other taste or olfactory receptors

  • Expression patterns in oral and extraoral tissues

Given that orangutans encounter different food resources in their arboreal rainforest habitat compared to more terrestrial apes, TAS2R7 may show adaptive changes related to:

  • Detection of alkaloids or other bitter compounds specific to Southeast Asian rainforest plants

  • Sensitivity to mineral content in available water sources

  • Warning mechanisms for potential toxins in their diet

These comparative studies would benefit from integration with behavioral and ecological data on feeding preferences in wild populations .

What strategies can overcome the challenges of low surface expression of recombinant Pongo pygmaeus TAS2R7?

Poor surface expression represents a common challenge when working with bitter taste receptors in heterologous systems. For Pongo pygmaeus TAS2R7, several strategies can enhance functional expression:

  • Signal sequence optimization:

    • Replace the native signal sequence with well-characterized, high-efficiency sequences such as those from rhodopsin or the Lucy tag system

    • Add an N-terminal epitope tag (FLAG, HA, or Rho) to both track expression and improve trafficking

  • Codon optimization:

    • Adjust codon usage to match the expression host (typically human cell lines)

    • Remove rare codons and optimize GC content

  • Chaperone co-expression:

    • Co-express with RTP3/4 and REEP1 chaperone proteins

    • Include Ric-8A or Ric-8B to enhance G protein coupling

  • Membrane-targeted expression:

    • Create fusion constructs with well-expressed membrane proteins (truncated CD8 or CD44)

    • Use inducible expression systems to prevent toxicity from constitutive expression

  • Post-translational modification enhancement:

    • Culture cells at reduced temperature (30-32°C) after transfection

    • Add chemical chaperones like 4-phenylbutyrate or glycerol to the culture medium

Verification of surface expression should utilize cell-surface biotinylation assays or non-permeabilized immunofluorescence with antibodies against N-terminal tags to quantify the fraction of receptor that successfully reaches the plasma membrane .

How can researchers address data variability in functional assays of recombinant Pongo pygmaeus TAS2R7?

Functional assays for bitter taste receptors often exhibit high variability, which can complicate data interpretation. To minimize variability when studying Pongo pygmaeus TAS2R7:

  • Standardize cell culture conditions:

    • Maintain consistent passage numbers (typically between P5-P20)

    • Standardize cell density at transfection and assay time

    • Use serum from single lots throughout a study

  • Optimize transfection parameters:

    • Determine ideal DNA:transfection reagent ratios empirically

    • Include reporter genes (e.g., GFP) to normalize for transfection efficiency

    • Consider stable cell lines for long-term studies

  • Refine assay methodology:

    • For calcium mobilization assays, standardize dye loading time and concentration

    • Use internal controls on each plate (dose-response to standard agonist)

    • Employ techniques less susceptible to day-to-day variation, such as BRET-based assays

  • Data analysis considerations:

    • Normalize responses to maximum response obtained with a reference compound

    • Use area-under-curve rather than peak height when appropriate

    • Apply statistical methods that account for day-to-day variability (mixed-effects models)

  • Filtering criteria for data quality:

    • Establish clear exclusion criteria for outliers based on control responses

    • Similar to criteria used in orangutan studies, exclude trials with extremely fast (<200 ms) or slow responses

    • Calculate median absolute deviation to identify outliers when analyzing response magnitudes

Implementation of these strategies can significantly reduce coefficients of variation and improve reproducibility across experiments .

What is the optimal approach for purifying recombinant Pongo pygmaeus TAS2R7 for structural studies?

Purification of GPCRs like TAS2R7 for structural studies presents significant challenges due to their hydrophobicity and instability when removed from the membrane environment. For Pongo pygmaeus TAS2R7, a comprehensive purification strategy would include:

  • Expression optimization:

    • Use specialized expression systems such as Sf9 insect cells or yeast

    • Add thermostabilizing mutations identified through alanine scanning

    • Include C-terminal and N-terminal tags to facilitate purification (e.g., His10, FLAG, or BRIL fusion)

  • Solubilization approaches:

    • Screen detergents systematically (DDM, LMNG, GDN)

    • Consider novel approaches such as SMALPs (styrene maleic acid lipid particles) to maintain native lipid environment

    • Test detergent-lipid mixed micelles with cholesterol and specific phospholipids

  • Chromatography strategy:

    • Two-step affinity purification using orthogonal tags

    • Size exclusion chromatography to isolate monomeric receptor

    • Consider lipid cubic phase crystallization directly after purification

  • Stability assessment:

    • Monitor thermal stability using CPM (7-diethylamino-3-(4-maleimidophenyl)-4-methylcoumarin) assays

    • Verify ligand binding capability after each purification step

    • Assess sample homogeneity through negative stain electron microscopy

  • Structure determination considerations:

    • For X-ray crystallography, incorporate T4 lysozyme or other fusion proteins to increase crystal contacts

    • For cryo-EM, ensure sufficient particle size through antibody fragments or nanobody complexes

    • For NMR, consider selective isotope labeling strategies

This multifaceted approach acknowledges the challenges in GPCR purification while leveraging advances in membrane protein structural biology to maximize chances of success .

What physiological role might TAS2R7 play in Pongo pygmaeus beyond taste perception?

Beyond its role in taste perception, TAS2R7 in Pongo pygmaeus likely serves important extraoral functions, similar to human TAS2R7. Based on emerging research in humans and other mammals, potential extraoral roles include:

  • Respiratory system functions:

    • Bronchodilation regulation in response to bitter compounds

    • Participation in innate immunity against airborne pathogens

    • Regulation of mucociliary clearance in the airways

  • Gastrointestinal roles:

    • Regulation of gastric emptying in response to potentially toxic compounds

    • Modulation of gut hormone release

    • Sensing of bacterial compounds in the intestinal lumen

  • Endocrine system connections:

    • Potential involvement in glucose homeostasis

    • Regulation of metal ion absorption in the digestive tract

    • Possible functions in mineral metabolism

  • Neurological implications:

    • Expression in specific brain regions for neurodevelopmental processes

    • Potential role in metal ion homeostasis in neural tissues

Of particular interest is the role of TAS2R7 as a broader sensor for physiologically relevant metal cations across different tissues, similar to the calcium-sensing receptor. This function may be especially important for orangutans given their primarily plant-based diet, which can vary significantly in mineral content .

How might diet composition in wild Pongo pygmaeus populations correlate with TAS2R7 genetic variants?

The dietary ecology of wild orangutans may exert selective pressure on taste receptor genes. For TAS2R7 specifically, researchers investigating genetic variants should consider the following approaches:

  • Population genetics analysis:

    • Sequence TAS2R7 from multiple wild orangutan populations across different habitats

    • Compare nucleotide diversity and non-synonymous/synonymous substitution rates with other taste receptor genes

    • Apply tests for selective sweeps or balancing selection

  • Diet-genotype correlation:

    • Document dietary preferences and food availability in sampled populations

    • Analyze metal content of preferred food items in different habitats

    • Test whether particular TAS2R7 variants correlate with dietary preferences or food availability

  • Functional validation:

    • Express identified variants in vitro and test responses to relevant compounds

    • Compare EC50 values and efficacy across variants

    • Create a comprehensive table of variant-specific responses to different ligands

TAS2R7 VariantZnSO4 EC50 (mM)CaCl2 EC50 (mM)MgCl2 EC50 (mM)Cromolyn EC50 (mM)
Wild type3.0-3.54.5-7.55.5-8.05.5-6.5
Variant 1 (e.g., H94A)TBDTBDTBDTBD
Variant 2 (e.g., E264A)TBDTBDTBDTBD

This research would provide insights into how taste perception may have evolved in response to ecological pressures and whether genetic variants of TAS2R7 contribute to individual dietary preferences in wild orangutan populations .

How should researchers interpret differences in ligand responses between human and Pongo pygmaeus TAS2R7?

When comparing ligand responses between human and Pongo pygmaeus TAS2R7, researchers should employ a systematic framework for data interpretation:

  • Differentiate pharmacological parameters:

    • Compare potency (EC50 values) separately from efficacy (maximum response)

    • Evaluate differences in activation kinetics and signal duration

    • Assess potential species differences in desensitization patterns

  • Statistical analysis considerations:

    • Use appropriate statistical tests that account for the hierarchical nature of the data

    • Implement mixed-effects models to separate biological variation from technical variation

    • Calculate confidence intervals rather than relying solely on p-values

  • Molecular basis investigation:

    • Identify amino acid differences in binding pocket residues

    • Create chimeric receptors exchanging domains between human and orangutan TAS2R7

    • Use reciprocal mutations to confirm the molecular basis of functional differences

  • Physiological relevance assessment:

    • Consider differences in terms of the natural diet and environment of each species

    • Evaluate whether differences occur at physiologically relevant concentration ranges

    • Relate findings to potential adaptive significance

When interpreting results, researchers should consider that differences might reflect not only direct adaptations to diet but also neutral drift or pleiotropic effects related to the receptor's extraoral functions. Additionally, technical factors such as expression level differences or G-protein coupling efficiency in heterologous systems must be controlled for before concluding true species differences exist .

What bioinformatic approaches can best predict potential ligands for Pongo pygmaeus TAS2R7?

Advanced bioinformatic approaches can accelerate the discovery of potential ligands for Pongo pygmaeus TAS2R7:

  • Homology-based prediction:

    • Leverage known human TAS2R7 ligands as a starting point

    • Apply sequence-based binding site prediction algorithms

    • Calculate binding pocket similarity scores between human and orangutan receptors

  • Machine learning approaches:

    • Implement random forest or support vector machine models trained on known bitter receptor-ligand pairs

    • Use chemical fingerprints and physicochemical descriptors of known ligands

    • Apply transfer learning from better-characterized bitter taste receptors

  • Molecular docking simulations:

    • Create refined homology models based on recent GPCR structures

    • Perform virtual screening of compound libraries against the binding pocket

    • Incorporate molecular dynamics to account for receptor flexibility

  • Pharmacophore modeling:

    • Develop 3D pharmacophore models based on known activators like cromolyn and metal ions

    • Identify critical features for receptor activation (hydrogen bond donors/acceptors, charged groups)

    • Screen natural product databases for compounds matching the pharmacophore

  • Evolutionary analysis approaches:

    • Identify binding pocket residues under positive selection

    • Compare with other primate TAS2R7 sequences to identify conserved interaction sites

    • Correlate residue conservation with chemical properties of potential ligands

These computational approaches should be followed by experimental validation of top-ranked compounds, with priority given to compounds found in the natural diet of orangutans or in their environment .

What novel experimental techniques could advance understanding of Pongo pygmaeus TAS2R7 function in vivo?

Advancing our understanding of TAS2R7 function in orangutans requires innovative approaches that bridge the gap between in vitro studies and physiological relevance:

  • Development of orangutan-derived organoids:

    • Establish tongue organoids from orangutan tissue samples

    • Create gastrointestinal organoids to study extraoral TAS2R7 function

    • Implement CRISPR-Cas9 genome editing in these systems to modify TAS2R7

  • Single-cell transcriptomics approaches:

    • Profile taste receptor cells from orangutan taste buds to determine co-expression patterns

    • Map TAS2R7 expression across extraoral tissues at single-cell resolution

    • Compare with human data to identify conserved and divergent expression patterns

  • In vivo imaging techniques:

    • Develop minimally invasive calcium imaging approaches for taste buds

    • Use PET tracers with selective TAS2R7 ligands to map receptor distribution

    • Implement functional near-infrared spectroscopy to measure responses to bitter compounds

  • Behavioral assays with selective ligands:

    • Design non-invasive preference tests using TAS2R7-specific compounds

    • Correlate behavioral responses with genetic variants

    • Develop automated systems for monitoring feeding choices in controlled environments

  • Metagenomic integration:

    • Analyze relationships between TAS2R7 variants and gut microbiome composition

    • Investigate whether microbial metabolites interact with TAS2R7

    • Study potential co-evolution between microbial communities and taste receptor function

These approaches would provide a more comprehensive understanding of TAS2R7 function in living orangutans while minimizing invasive procedures in this endangered species .

What are the implications of TAS2R7 research for orangutan conservation efforts?

Research on Pongo pygmaeus TAS2R7 has several important implications for conservation efforts:

  • Habitat management considerations:

    • Identification of essential bitter compounds in the natural diet could inform habitat protection priorities

    • Understanding mineral sensing via TAS2R7 might highlight the importance of maintaining natural mineral sources

    • Knowledge of taste preferences could guide reforestation efforts with preferred plant species

  • Captive care applications:

    • Optimization of diets in rehabilitation centers based on TAS2R7 ligand profiles

    • Improvement of medicinal administration through better masking of bitter components

    • Development of enrichment activities that account for taste preferences

  • Population management insights:

    • Genetic screening of TAS2R7 variants could help assess population diversity

    • Understanding of sensory adaptations might inform translocation decisions

    • Identification of locally adapted variants could guide breeding programs

  • Monitoring environmental changes:

    • TAS2R7 research might reveal sensitivities to compounds associated with climate change

    • Potential impacts of habitat degradation on food quality could be assessed

    • Monitoring of anthropogenic bitter compounds in orangutan habitats

This research sits at the intersection of molecular biology, sensory ecology, and conservation biology, potentially providing valuable insights for evidence-based conservation strategies for this endangered species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.