Recombinant Pongo pygmaeus Taste receptor type 2 member 8 (TAS2R8)

Shipped with Ice Packs
In Stock

Description

Product Overview ( )

ParameterDetails
Expression SystemE. coli
Purity>90% (SDS-PAGE verified)
Storage-20°C/-80°C in Tris/PBS buffer with 50% glycerol
TagHis-tag (N-terminal)
ApplicationsELISA, functional assays, structural studies

Anti-Cancer Stemness and Invasion

  • Neuroblastoma Suppression: Overexpression of TAS2R8 in neuroblastoma cells reduces cancer stem cell (CSC) markers (DLK1, CD133) and inhibits tumorigenicity. It also suppresses metastasis by downregulating HIF-1α, VEGF, and MMP activity .

  • Mechanism: Induces neurite elongation and neuronal differentiation via retinoic acid pathways .

Evolutionary and Dietary Adaptations

  • Gene Duplication: Primate TAS2R genes, including TAS2R8, show lineage-specific duplications linked to dietary adaptations. For example, Cercopithecidae species exhibit expanded TAS2R repertoires to detect plant toxins .

  • Functional Divergence: Duplicated TAS2R copies in primates undergo rapid functional diversification, enhancing bitter compound detection breadth .

Comparative Analysis with Related Proteins

Recombinant TAS2R8 is part of a broader family of taste receptors studied in primates:

ProteinSpeciesUniProt IDKey Differences
TAS2R10Pongo pygmaeusQ645V0Longer sequence (308 aa); distinct ligand specificity
TAS2R42Pongo pygmaeusQ645U9314 aa; associated with broader bitter compound detection

Research Applications and Future Directions

  • Therapeutic Potential: TAS2R8’s role in CSC suppression highlights its utility in targeted cancer therapies .

  • Functional Studies: Structural modeling and ligand-binding assays are needed to map its activation mechanisms .

  • Comparative Genomics: Further analysis of TAS2R8 orthologs may clarify evolutionary drivers of bitter taste adaptation in primates .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
TAS2R8; Taste receptor type 2 member 8; T2R8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Pongo pygmaeus (Bornean orangutan)
Target Names
Target Protein Sequence
MFSPADNIFIILITGEFILGILGNGYIALVNWIDWIKKKKISTTDYILTNLVISRICLIS VIVVNGIVTVLYPDVYTKSKLQIAISTFWTFANYLNMWFTTCLNVFYFLKIANSSHPLFL WLKQKIDMVVRWILLGCFAISLLVSLIIAIVLSRDYRFHAIAKHKRNITEMFHVSKMLYF EPLTLFNLLAIVPFIVSLMSFFLLVRSLQRHTKQIKLYATGGRDPSTEAHVRAIKTMTSF IFFFFLYYITSLLVTFSYLMTKYKLAMAFGEIVAILYPSGHSFILIILNNKLRQASVRML TCIKITCVI
Uniprot No.

Target Background

Function
This receptor may play a role in the perception of bitterness and is gustducin-linked. It may also contribute to sensing the chemical composition of the gastrointestinal contents. The activity of this receptor potentially stimulates alpha gustducin, mediates PLC-beta-2 activation, and leads to the gating of TRPM5.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.