Recombinant Pongo pygmaeus Tetraspanin-7 (TSPAN7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill them accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
TSPAN7; TM4SF2; Tetraspanin-7; Tspan-7; Transmembrane 4 superfamily member 2; CD antigen CD231
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Pongo pygmaeus (Bornean orangutan)
Target Names
TSPAN7
Target Protein Sequence
METKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPYVLIGT GTTIVVFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYT DAMQTYDGKDDRSQAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQD LHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSRFITANQ YEMV
Uniprot No.

Target Background

Function
Tetraspanin-7 (TSPAN7) is a protein that may be involved in cell proliferation and cell motility.
Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for maintaining TSPAN7 stability?

For optimal stability of Recombinant Pongo pygmaeus TSPAN7:

  • Store at -20°C for regular storage

  • For extended preservation, maintain at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles as this severely compromises protein integrity

  • Working aliquots can be safely stored at 4°C for up to one week

  • The protein is typically supplied in a Tris-based buffer with 50% glycerol optimized for stability

Experimental considerations include:

  • Division of stock solutions into single-use aliquots immediately upon receipt

  • Use of low-protein binding microcentrifuge tubes

  • Addition of protease inhibitors for extended experimental procedures

  • Maintenance of cold chain during all handling procedures

How can researchers validate TSPAN7 activity for experimental applications?

Methodological approaches for validating recombinant TSPAN7 include:

Validation ApproachMethodologyExpected Outcome
Structural IntegritySDS-PAGE analysisSingle band at expected molecular weight (≥85% purity)
Protein IdentityWestern blot with anti-TSPAN7 antibodiesSpecific band recognition at ~25 kDa
Functional AssessmentCo-immunoprecipitation with PICK1Detectable protein-protein interaction
Biological ActivityDendritic spine morphology assaysIncreased spine density in neuronal cultures
Binding CapacitySurface plasmon resonanceSpecific binding to known partners (integrin β1, PI4K)

Researchers should select validation methods based on their specific experimental goals, with special attention to functional assays that confirm the protein's ability to interact with known neuronal binding partners.

How can researchers effectively investigate TSPAN7's role in AMPAR trafficking and synaptic plasticity?

TSPAN7 regulates AMPAR trafficking through interaction with PICK1, critically affecting excitatory synapse development and function . A comprehensive experimental approach should include:

Protein-Protein Interaction Analysis:

  • Co-immunoprecipitation assays with PICK1 and AMPAR subunits (GluA2/GluA3)

  • Pull-down assays using the C-terminus of TSPAN7, which has been shown to directly interact with PICK1

  • Fluorescence resonance energy transfer (FRET) analysis to visualize interactions in live neurons

AMPAR Trafficking Assessment:

  • Surface biotinylation assays to quantify AMPAR internalization rates

  • Live imaging with pH-sensitive GFP-tagged AMPARs to track receptor movement

  • Antibody feeding assays to monitor receptor endocytosis in response to TSPAN7 manipulation

Electrophysiological Measurements:

  • Whole-cell patch-clamp recordings of AMPAR-mediated currents

  • Miniature excitatory postsynaptic current (mEPSC) analysis

  • AMPA/NMDA ratio assessments to evaluate synaptic strength changes

  • Long-term potentiation (LTP) protocols to assess synaptic plasticity

The interaction of TSPAN7 with PICK1 attenuates AMPAR internalization, leading to increased receptor availability at the postsynaptic membrane and enhanced neuronal excitability . This methodology enables researchers to comprehensively evaluate how TSPAN7 modulates glutamatergic transmission.

What approaches should be used to reconcile contradictory findings regarding TSPAN7 expression across different cancer types?

Analysis of TSPAN family gene expression across cancer types reveals complex patterns, with TSPAN7 predominantly downregulated while many other family members are upregulated . To address these contradictions:

Multi-Omics Integration:

  • Combine transcriptomic data (FPKM and HTSeq-counts) across 33 cancer types

  • Correlate expression patterns with methylation status and copy number variations

  • Employ Wilcox tests for differential analysis between tumor and normal tissues

  • Use R package "corrplot" for co-expression analysis to identify patterns across TSPAN family members

Standardized Analytical Framework:

  • Apply consistent statistical methods (R version 4.1.0, GraphPad Prism 8)

  • Use two-tailed tests with significance threshold p < 0.05

  • Present data as log2 fold change (log2 FC) for consistent comparison

  • Analyze protein-protein interaction networks using STRING database to identify context-specific binding partners

Cancer Type-Specific Analysis:

  • Examine TSPAN7 expression in relation to cancer molecular subtypes

  • Conduct immunohistochemical staining across multiple cancer types

  • Compare expression patterns in primary tumors versus metastatic sites

  • Correlate expression with patient outcomes using Kaplan-Meier survival analysis

This methodological approach can explain why TSPAN7 shows differential expression patterns across cancer types and reconcile seemingly contradictory findings in the literature.

How can genetic manipulation experiments be designed to study TSPAN7 function in neuronal development?

TSPAN7 influences neuronal morphogenesis by regulating filopodia density and dendritic spine morphology . A comprehensive genetic manipulation strategy should include:

Overexpression Systems:

  • Lentiviral vector construction for TSPAN7 overexpression

  • Transfection protocol following manufacturer's instructions (48-72 hours incubation)

  • Efficiency analysis using fluorescence microscopy

  • Construction of fluorescently-tagged TSPAN7 for live tracking

Gene Silencing Approaches:

  • CRISPR-Cas9 knockout of TSPAN7 in neuronal cultures

  • shRNA-mediated knockdown for transient expression reduction

  • Design of domain-specific mutants to identify critical functional regions

  • Rescue experiments with wild-type TSPAN7 to confirm specificity

Functional Readouts:

  • High-resolution imaging of dendritic spine morphology

  • Quantification of spine density, size, and maturation state

  • Analysis of actin cytoskeleton dynamics

  • Electrophysiological assessment of synaptic function

Interaction Partner Analysis:

  • Mutational analysis of the TSPAN7 C-terminus that interacts with PICK1

  • Evaluation of interactions with integrin β1 and PI4K

  • Assessment of downstream effects on actin cytoskeleton remodeling

  • Investigation of AMPAR subunit trafficking (GluA2/GluA3)

These approaches enable researchers to comprehensively characterize how TSPAN7 influences neuronal development and synaptic function, particularly through its interactions with key binding partners.

What cell and animal models are most appropriate for studying TSPAN7 in intellectual disability research?

Mutations in the TM4SF2 gene (TSPAN7) cause X-linked intellectual disability , necessitating appropriate model systems:

Cellular Models:

  • Primary hippocampal neuronal cultures from rodents

  • iPSC-derived neurons from patients with TSPAN7 mutations

  • SH-SY5Y neuroblastoma cells with TSPAN7 modifications

  • Neuro2A cells for preliminary mechanism studies

Animal Models:

  • TSPAN7 knockout mice that recapitulate intellectual disability phenotypes

  • Conditional knockout models for temporal-specific TSPAN7 deletion

  • Knockin models harboring human disease-associated mutations

  • Xenopus and zebrafish models for developmental studies

Therapeutic Testing Models:

  • Models treated with ampakine CX516, which rescues intellectual disability phenotypes in Tspan7 knockout mice

  • Paradigms for AMPAR modulation as potential therapeutic interventions

  • Behavioral testing batteries focused on learning and memory tasks

  • Electrophysiological studies to correlate with behavioral outcomes

The comprehensive use of these models allows researchers to bridge molecular mechanisms to behavioral outcomes, particularly focusing on how TSPAN7 mutations affect glutamatergic synaptic transmission and potential therapeutic interventions.

What advanced imaging techniques should be employed to track TSPAN7 trafficking in neurons?

To investigate the dynamic subcellular localization of TSPAN7 in neurons:

Super-Resolution Microscopy:

  • Stimulated Emission Depletion (STED) microscopy for visualizing TSPAN7 within dendritic spines

  • Stochastic Optical Reconstruction Microscopy (STORM) for nanoscale localization

  • Structured Illumination Microscopy (SIM) for improved resolution in live cells

  • Expansion microscopy for physical magnification of subcellular structures

Live-Cell Imaging Approaches:

  • Single-particle tracking with quantum dots or photoswitchable fluorescent proteins

  • Fluorescence Recovery After Photobleaching (FRAP) to measure mobility

  • Pulse-chase labeling with self-labeling protein tags (SNAP, CLIP, Halo)

  • Lattice light-sheet microscopy for long-term imaging with minimal phototoxicity

Multi-Modal Integration:

  • Correlative Light and Electron Microscopy (CLEM) to link fluorescence with ultrastructure

  • Combined calcium imaging with TSPAN7 trafficking to correlate with activity

  • Optogenetic manipulation coupled with live imaging

  • Dual-color imaging to simultaneously track TSPAN7 and AMPAR subunits

These techniques can elucidate how TSPAN7 regulates AMPAR trafficking and influences dendritic spine morphology, providing mechanistic insights into its function at excitatory synapses.

How can bioinformatic approaches be utilized to analyze TSPAN7 expression in cancer datasets?

For comprehensive bioinformatic analysis of TSPAN7 in cancer:

Data Collection and Processing:

  • Obtain multimodal data of TSPAN family genes across 11,057 samples from 33 cancer types

  • Perform read count assignment and analyze transcriptional levels by calculating FPKM and HTSeq-counts

  • Incorporate demographics, follow-up information, and tumor characteristics from databases such as TCGA and GEO

Expression Analysis Pipeline:

  • Apply Wilcox tests for differential analysis between tumor and normal tissues

  • Generate heatmaps representing log2 fold change (log2 FC) of expression

  • Perform co-expression analysis of 24 TSPAN family genes at the transcriptional level

  • Visualize data using R packages including "ggpubr" and "corrplot"

Integration with Clinical Data:

  • Correlate TSPAN7 expression with survival outcomes using Kaplan-Meier analyses

  • Apply T-tests for normally distributed variables and Wilcoxon-tests otherwise

  • Set statistical significance at p < 0.05 using two-tailed tests

  • Explore correlations between variables using Pearson or Spearman coefficients

This methodological framework allows researchers to comprehensively analyze TSPAN7 expression patterns across cancer types and correlate findings with clinical outcomes.

How can TSPAN7 research findings inform potential therapeutic approaches for X-linked intellectual disability?

Research shows that TSPAN7 mutations cause cognitive impairment through disruption of glutamatergic synaptic transmission . Translational approaches include:

Therapeutic Target Identification:

  • Focus on the TSPAN7-PICK1-AMPAR regulatory axis

  • Identify small molecules that can mimic TSPAN7's effect on AMPAR trafficking

  • Develop peptide inhibitors targeting specific interaction interfaces

  • Screen for compounds that enhance remaining TSPAN7 function in mutant proteins

Pharmacological Interventions:

  • Further development of ampakine CX516, which rescues intellectual disability phenotypes in Tspan7 knockout mice

  • Testing of other AMPAR positive allosteric modulators

  • Investigation of actin cytoskeleton modulators to address dendritic spine abnormalities

  • Evaluation of PI4K activators as TSPAN7 interacts with this kinase

Delivery Methodologies:

  • Development of blood-brain barrier-penetrant compounds

  • Design of gene therapy approaches to restore TSPAN7 expression

  • Creation of non-viral delivery systems for TSPAN7 mRNA

  • Implementation of nanobody-based approaches to modulate TSPAN7 interactions

These translational approaches build directly on mechanistic insights into how TSPAN7 influences dendritic spine morphology and AMPAR trafficking, providing multiple potential therapeutic avenues.

What are the methodological considerations for studying TSPAN7 as a biomarker in glioma progression?

TSPAN7 decreases in high-grade gliomas and its low expression correlates with poor prognosis . Methodological considerations include:

Sample Collection and Processing:

  • Standardized protocols for tissue preservation and processing

  • Matched tumor-normal pairs when possible

  • Stratification by glioma grade and molecular subtype

  • Inclusion of temporal samples to track expression changes during progression

Expression Analysis:

  • Immunohistochemistry with validated antibodies

  • Quantitative RT-PCR for transcript measurement

  • Western blotting for protein quantification

  • Single-cell RNA sequencing for cell-type specific expression patterns

Validation Approaches:

  • Construction of TSPAN7 overexpression lentivirus following standardized protocols

  • Transfection for 48-72 hours followed by fluorescence microscopy validation

  • Functional assays in patient-derived glioma cells

  • Correlation with established glioma biomarkers

Statistical Analysis Framework:

  • Use of R version 4.1.0 and GraphPad Prism 8 for consistency

  • Application of appropriate statistical tests (T-test for normal distribution, Wilcoxon-test otherwise)

  • Correlation analysis using Pearson or Spearman coefficients

  • Survival analysis with multivariate Cox regression to establish independent prognostic value

These methodological considerations ensure robust evaluation of TSPAN7 as a potential biomarker for glioma progression and patient stratification.

How does Pongo pygmaeus TSPAN7 compare with human TSPAN7 in functional studies?

Comparative analysis of Pongo pygmaeus and human TSPAN7 provides insights into evolutionary conservation and functional significance:

Sequence Analysis:

  • Alignment of Pongo pygmaeus TSPAN7 (UniProt: Q7YQK9) with human TSPAN7

  • Identification of conserved functional domains, particularly transmembrane regions

  • Analysis of the large extracellular loop (LEL) responsible for most protein-protein interactions

  • Determination of conserved post-translational modification sites

Functional Comparison:

  • Parallel expression in neuronal systems to assess effects on dendritic spine formation

  • Comparative binding assays with known interaction partners (PICK1, integrin β1, PI4K)

  • Cross-species rescue experiments in knockout models

  • Analysis of differential effects on AMPAR trafficking

Structural Biology Approaches:

  • Comparative modeling of protein structure

  • Analysis of species-specific differences in protein folding

  • Evaluation of membrane insertion and topology

  • Identification of critical residues for function

This comparative approach provides insights into evolutionarily conserved functions of TSPAN7 and validates the use of Pongo pygmaeus TSPAN7 as a model for human protein function.

How do different expression systems affect the functional properties of recombinant TSPAN7?

The choice of expression system significantly impacts TSPAN7 functionality:

Expression SystemAdvantagesLimitationsOptimal Applications
E. coliHigh yield, cost-effectiveLimited post-translational modificationsStructural studies, antibody production
YeastHigher eukaryotic processing, economicalGlycosylation patterns differ from mammalsProtein-protein interaction studies
Baculovirus/Insect cellsBetter folding, some mammalian-like modificationsMore complex, higher costFunctional assays requiring proper folding
Mammalian cell expressionNative-like folding and modificationsHighest cost, lower yieldPhysiologically relevant functional studies
Cell-free expressionRapid production, avoids toxicityMay lack post-translational modificationsPreliminary binding studies, HTS assays

For membrane proteins like TSPAN7, researchers should consider:

  • The need for proper post-translational modifications for function

  • Requirements for correct membrane insertion and topology

  • The importance of glycosylation for protein-protein interactions

  • Whether the experimental design requires native-like protein or can utilize partially processed forms

Careful selection of the expression system based on experimental requirements ensures optimal TSPAN7 functionality for specific research applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.