Recombinant Populus alba Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Populus alba (White poplar)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVGIEVPQAVLPDTVFEAVVRIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQSYRPAKKNILVIGPVPG QKYSEITFPILSPDPAAKKDTHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVS KIIRKEKGGYEITITDAPEGRQVIDSIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
Recombinant Populus alba Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the genomic context of the petA gene in Populus alba?

The petA gene is encoded in the chloroplast genome of Populus alba. Genome studies have shown that the petA gene is located in a specific region of the chloroplast genome, often referred to as the petA/petL region. This region has been extensively studied in horizontal genome transfer research and chloroplast transformation experiments . The chloroplast genome organization is highly conserved among Populus species, with the petA gene maintaining its essential function in the photosynthetic electron transport chain. Genomic studies in related Populus species, such as the hybrid aspen Populus tremula × P. alba, have provided valuable insights into the evolution and functional importance of this gene region .

What expression systems are optimal for producing recombinant Populus alba Apocytochrome f?

For recombinant production of Populus alba Apocytochrome f, Escherichia coli expression systems have proven most effective. The mature protein sequence (amino acids 36-320) is commonly expressed with an N-terminal histidine tag for purification purposes . When designing expression vectors, researchers should consider:

  • Codon optimization for E. coli expression

  • Selection of appropriate promoter systems (T7 is commonly used)

  • Inclusion of appropriate fusion tags (His-tag being the most common)

  • Expression conditions optimization (temperature, IPTG concentration, induction time)

The bacterial expression offers several advantages over other systems:

Expression SystemAdvantagesDisadvantages
E. coliHigh yield, rapid growth, cost-effectivePotential for improper folding
YeastBetter folding, post-translational modificationsLower yield, longer culture time
Insect cellsSuperior folding, some PTMsExpensive, technically demanding
Plant-basedNative-like modificationsLow yield, time-consuming

For most basic research applications, E. coli expression systems provide the optimal balance of yield and functionality .

What are the critical factors for maintaining stability of purified recombinant Apocytochrome f preparations?

Maintaining stability of purified recombinant Apocytochrome f requires attention to several critical factors:

  • Storage conditions: Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles .

  • Buffer composition: Optimal stability is achieved in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

  • Reconstitution protocol:

    • Centrifuge vial briefly before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL concentration

    • Add 5-50% glycerol (final concentration) for long-term storage (50% is recommended as default)

  • Working conditions: Working aliquots may be stored at 4°C for up to one week, but repeated freezing and thawing significantly reduces protein stability and should be avoided .

How can recombinant Apocytochrome f be used to study electron transport in photosystem research?

Recombinant Apocytochrome f serves as a valuable tool for investigating electron transport in photosystem research through several methodological approaches:

  • Reconstitution studies: The purified protein can be incorporated into artificial membrane systems or liposomes to study electron transport rates under controlled conditions. Researchers can systematically alter lipid composition, redox partners, and environmental conditions to determine their effects on electron transport efficiency.

  • Structure-function analysis: Site-directed mutagenesis of specific residues in the recombinant protein allows for detailed investigation of amino acids critical for electron transfer reactions. Key residues can be identified by creating a library of mutants and assessing their functional impact through spectroscopic techniques.

  • Protein-protein interaction studies: Using techniques such as surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) with the recombinant protein allows researchers to quantify binding affinities with other components of the photosynthetic apparatus.

  • Comparative studies: The Populus alba Apocytochrome f can be compared with orthologs from other plant species to identify evolutionary adaptations in electron transport systems across different photosynthetic organisms .

These approaches collectively enable researchers to develop detailed models of electron transport pathways in photosynthesis, providing insights into both fundamental biological processes and potential applications in synthetic biology.

What methodologies can be used to study interactions between recombinant Apocytochrome f and other components of the cytochrome b6f complex?

Several sophisticated methodologies can be employed to investigate interactions between recombinant Apocytochrome f and other components of the cytochrome b6f complex:

  • Co-immunoprecipitation assays: Using antibodies against the His-tag of recombinant Apocytochrome f to pull down interacting partners from chloroplast extracts or reconstituted systems.

  • Cross-linking mass spectrometry (XL-MS): This technique identifies interaction interfaces by chemically cross-linking proteins in close proximity, followed by mass spectrometric analysis to identify cross-linked peptides, providing spatial constraints for structural modeling.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This approach maps regions of conformational change upon complex formation by measuring the rate of hydrogen-deuterium exchange in different protein regions.

  • Cryo-electron microscopy: When combined with other cytochrome b6f components, the recombinant protein can be used for structural studies to visualize the assembled complex at near-atomic resolution.

  • Förster resonance energy transfer (FRET): By labeling recombinant Apocytochrome f and potential interaction partners with fluorophore pairs, researchers can detect and quantify protein-protein interactions in real-time.

Data analysis typically involves comparing binding affinities, interaction kinetics, and structural changes across different experimental conditions to build comprehensive interaction models of the cytochrome b6f complex assembly and function .

How does the petA gene differ between Populus alba and its hybrid species in terms of sequence conservation and functional adaptation?

The petA gene shows intriguing patterns of sequence conservation and functional adaptation between Populus alba and its hybrid species:

Comparative genomic analyses reveal that while the core functional domains of petA are highly conserved across Populus species, there are subtle sequence variations that may contribute to functional adaptations in different ecological niches. In hybrid species such as Populus tremula × P. alba, the petA gene demonstrates interesting patterns of inheritance and expression .

Studies of chloroplast genome inheritance in Populus hybrids show that the petA gene region can be a hotspot for recombination during hybridization events. Specific nucleotide polymorphisms in this region may confer subtle adaptations in photosynthetic efficiency under different environmental conditions .

The petA/petL region has been identified as significant in horizontal genome transfer studies, suggesting this region may play a role in chloroplast capture phenomena observed in natural Populus populations . These horizontal transfer events may contribute to adaptive evolution by introducing new genetic variations into recipient species.

Genomic comparisons between white poplar (Populus alba) and its hybrids with European aspen, quaking aspen, and bigtooth aspen have shown that chloroplast genes like petA can exhibit maternal inheritance patterns, though exceptions occur through horizontal genome transfer mechanisms .

What insights can the study of petA sequence variations provide about the evolutionary history of Populus species?

The study of petA sequence variations provides significant insights into the evolutionary history of Populus species:

  • Phylogenetic relationships: Sequence variations in the petA gene serve as molecular markers that help reconstruct evolutionary relationships among Populus species. These variations can be used to construct phylogenetic trees that illustrate the divergence patterns and evolutionary history of different poplar lineages .

  • Introgression and hybridization events: The petA gene region has been implicated in horizontal genome transfer between Populus species, particularly at natural graft sites. Analysis of petA sequence variations can reveal historical hybridization events and instances of chloroplast capture where the chloroplast genome of one species is replaced by that of another through introgression .

  • Adaptive evolution signatures: Comparative analysis of petA sequences across Populus species inhabiting different ecological niches can reveal signatures of positive selection, indicating adaptive evolution of the photosynthetic apparatus. These adaptations may be related to environmental factors such as light intensity, temperature ranges, or water availability .

  • Biogeographical patterns: The distribution of specific petA haplotypes across geographical regions provides insights into the historical migration and range expansion of Populus species following glacial periods .

  • Speciation mechanisms: Analysis of petA divergence patterns in conjunction with nuclear markers can help understand the relative contributions of allopatric speciation, sympatric speciation, and hybridization in generating the current diversity of Populus species .

By integrating petA sequence data with ecological, geographical, and paleobotanical information, researchers can develop comprehensive models of Populus evolution that inform both basic evolutionary biology and applied conservation strategies for these ecologically important tree species.

How can recombinant Apocytochrome f be utilized in chloroplast transformation studies of Populus species?

Recombinant Apocytochrome f can be strategically utilized in chloroplast transformation studies of Populus species through several sophisticated approaches:

  • Marker gene applications: The petA gene region can serve as an integration site for transgenes in chloroplast transformation experiments. Recombinant Apocytochrome f can be used to develop selectable marker systems where a modified petA sequence confers resistance to specific inhibitors of photosynthetic electron transport .

  • Homologous recombination targeting: The recombinant protein's gene sequence can be used to design homologous flanking regions for precise transgene insertion into the chloroplast genome. This approach enables site-specific integration into the petA/petL region without disrupting essential photosynthetic functions .

  • Functional complementation studies: In petA mutant lines with compromised photosynthetic function, the introduction of variant recombinant Apocytochrome f sequences through chloroplast transformation can assess functional complementation capabilities, providing insights into structure-function relationships of specific protein domains .

  • Promoter analysis: The native petA promoter regions from Populus alba can be studied using recombinant constructs to understand regulation of chloroplast gene expression in woody plant species, which differ from herbaceous model systems in their developmental patterns and environmental responses .

  • Interspecific compatibility assessment: By transforming chloroplasts with petA sequences from different Populus species, researchers can investigate interspecific compatibility of photosynthetic components and potential adaptive advantages of different natural variants .

These approaches capitalize on the dual role of recombinant Apocytochrome f as both a research tool and a target for genetic engineering in tree improvement programs focused on photosynthetic efficiency.

What methodologies are most effective for analyzing conformational changes in recombinant Apocytochrome f under varying redox conditions?

Analysis of conformational changes in recombinant Apocytochrome f under varying redox conditions requires sophisticated biophysical techniques:

Data analysis typically involves comparing structural parameters across multiple redox states (fully reduced, fully oxidized, and intermediate states) under varying pH and temperature conditions to develop comprehensive models of redox-linked conformational dynamics .

What are the common challenges in expressing and purifying functional recombinant Apocytochrome f and how can they be addressed?

Researchers frequently encounter several challenges when expressing and purifying functional recombinant Apocytochrome f:

  • Protein misfolding and inclusion body formation:

    • Challenge: As a membrane-associated protein, Apocytochrome f often forms inclusion bodies in E. coli expression systems.

    • Solution: Optimize expression conditions by reducing temperature (16-20°C), using lower inducer concentrations, and experimenting with specialized E. coli strains (such as Origami or SHuffle) that facilitate disulfide bond formation. Alternatively, solubilization and refolding protocols using mild detergents can recover properly folded protein from inclusion bodies .

  • Heme incorporation issues:

    • Challenge: Proper functioning requires correct incorporation of heme cofactors.

    • Solution: Co-express heme biosynthesis genes or supplement growth media with δ-aminolevulinic acid to increase cellular heme production. Alternatively, in vitro heme reconstitution protocols can be employed post-purification.

  • Proteolytic degradation:

    • Challenge: The recombinant protein may undergo proteolysis during expression or purification.

    • Solution: Include protease inhibitors throughout the purification process, use protease-deficient host strains, and maintain low temperatures during all handling steps. Optimize buffer conditions (pH 8.0 is typically effective) to minimize degradation .

  • Protein aggregation during concentration:

    • Challenge: The protein tends to aggregate when concentrated for experimental applications.

    • Solution: Include stabilizing agents such as trehalose (6%) or glycerol in storage buffers, and use step-wise concentration methods rather than rapid concentration. Centrifugal concentrators with appropriate molecular weight cutoffs prevent protein loss .

  • Low functional activity:

    • Challenge: The purified protein may show reduced electron transport activity.

    • Solution: Verify proper folding using spectroscopic methods before functional assays. Consider native PAGE analysis to confirm the protein exists in the proper oligomeric state. Activity can often be improved by optimizing buffer compositions with appropriate redox agents.

How can researchers resolve data inconsistencies when comparing in vitro studies of recombinant Apocytochrome f with in vivo chloroplast function?

Resolving data inconsistencies between in vitro studies of recombinant Apocytochrome f and in vivo chloroplast function requires systematic methodological approaches:

  • Protein modification assessment:

    • Inconsistency source: Recombinant proteins may lack critical post-translational modifications present in native chloroplasts.

    • Resolution approach: Compare mass spectrometric profiles of native and recombinant proteins to identify missing modifications. When critical modifications are identified, develop expression systems capable of introducing these modifications or employ chemical biology approaches to add them post-purification.

  • Membrane environment differences:

    • Inconsistency source: The lipid composition of artificial membrane systems rarely matches the native thylakoid membrane environment.

    • Resolution approach: Develop reconstitution systems with lipid compositions that more closely mimic native thylakoid membranes. Use lipidomics data from Populus chloroplasts to guide the formulation of more authentic membrane mimetics for functional studies.

  • Protein-protein interaction network incompleteness:

    • Inconsistency source: In vitro systems often lack the full complement of interaction partners present in chloroplasts.

    • Resolution approach: Identify missing interaction partners through comparative proteomics of isolated thylakoid membranes. Develop more complex reconstitution systems that include key interaction partners, particularly those that may regulate electron transport rates.

  • Redox potential differences:

    • Inconsistency source: The redox environment in vitro often differs from the highly regulated redox conditions in chloroplasts.

    • Resolution approach: Use redox buffers that more accurately mimic physiological conditions. Employ cyclic voltammetry to quantify and standardize redox potentials across experimental systems.

  • Data normalization and scaling issues:

    • Inconsistency source: Different metrics and normalization methods between in vitro and in vivo studies.

    • Resolution approach: Develop standardized activity assays and common reference points that can be measured in both systems. Employ mathematical modeling to translate between different measurement systems and develop scaling factors that account for differences in protein concentration, membrane geometry, and other variables.

By systematically addressing these inconsistency sources, researchers can develop more predictive in vitro systems and better understand the limitations of recombinant protein studies in the context of whole chloroplast function .

How might recombinant Apocytochrome f be utilized in studying chloroplast horizontal gene transfer in Populus species?

Recombinant Apocytochrome f offers innovative approaches for investigating chloroplast horizontal gene transfer (HGT) in Populus species:

  • Transgenic marker systems: Engineered recombinant Apocytochrome f with specific detectable modifications (fluorescent tags or epitope markers) can be introduced into donor plants, allowing researchers to track potential horizontal transfer events. When grafting experiments are performed between the modified donor and wild-type recipients, any transfer of the modified petA sequence can be detected through molecular and microscopic techniques .

  • Transfer mechanism elucidation: Using recombinant constructs with the petA gene region as a backbone, researchers can investigate the molecular mechanisms facilitating chloroplast genome transfer. Different flanking sequences can be tested to identify genomic elements that enhance or inhibit horizontal transfer rates at graft junctions or in natural root contact zones .

  • Ecological significance assessment: By introducing recombinant variants with altered functional properties (e.g., modified electron transport efficiency under different temperature regimes), researchers can evaluate the potential adaptive significance of horizontal gene transfer events. This approach allows for experimental testing of the hypothesis that chloroplast capture provides adaptive advantages in specific ecological contexts .

  • Historical transfer detection: The recombinant protein's gene sequence can serve as a reference for developing molecular probes and PCR primers that detect evidence of historical horizontal transfer events in natural Populus populations. These tools can help reconstruct the frequency and distribution of past chloroplast capture events across different Populus species and hybrids .

  • Interspecific compatibility testing: Recombinant Apocytochrome f variants from different Populus species can be used to assess functional compatibility in heterologous backgrounds, providing insights into the molecular constraints and opportunities that shape the outcomes of horizontal transfer events .

This research direction bridges fundamental evolutionary biology with applied aspects of genetic engineering and has significant implications for understanding speciation mechanisms and developing novel approaches for tree improvement programs.

What potential applications exist for utilizing bacterial endophytes in conjunction with recombinant Apocytochrome f studies in Populus alba?

The integration of bacterial endophyte research with recombinant Apocytochrome f studies in Populus alba opens several innovative research directions:

  • Enhanced photosynthetic efficiency: Certain bacterial endophytes, particularly those from the genera Pseudomonas and Kocuria, have been shown to enhance plant growth in Populus alba . By combining these endophytes with studies using recombinant Apocytochrome f variants, researchers can investigate potential synergistic effects on photosynthetic electron transport efficiency. This approach could identify bacterial strains that specifically enhance the performance of certain petA variants under stress conditions.

  • Stress response modulation: Bacterial endophytes isolated from Populus alba roots contain genes involved in detoxification of heavy metals and organic pollutants . Combining these bacteria with recombinant Apocytochrome f studies could reveal how endophytes influence the redox state of chloroplasts under stress conditions, potentially protecting the photosynthetic apparatus from oxidative damage.

  • Metabolic engineering platforms: The whole-genome sequencing of bacterial endophytes from Populus alba has revealed genes involved in enhanced metabolism of nitrogen, phosphorus, and metals . These metabolic capabilities could be harnessed to create optimized experimental systems for studying recombinant Apocytochrome f function under varying nutrient conditions.

  • Bioinoculant development: Research combining bacterial endophytes with recombinant Apocytochrome f studies could lead to the development of specialized bioinoculants that target specific aspects of photosynthetic performance in Populus alba. This approach bridges fundamental research with applied biotechnology for sustainable forestry.

  • Environmental adaptation mechanisms: Investigating how bacterial endophytes influence the expression and function of chloroplast genes like petA could provide insights into the mechanisms by which Populus alba adapts to challenging environmental conditions. This research direction has significant implications for understanding plant-microbe coevolution and developing strategies for forest resilience under climate change scenarios .

This integrated approach represents a frontier in plant-microbe interaction research with potential applications in bioremediation, sustainable forestry, and bioenergy production using Populus alba and related species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.