Recombinant Populus alba ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Function

ATP synthase subunit a (atpI) is a transmembrane component of the chloroplast ATP synthase complex (F₀F₁-ATPase), which catalyzes ATP synthesis during photosynthesis . In Populus alba, this subunit is encoded by the atpI gene (UniProt ID: Q14FG9) and plays a pivotal role in proton translocation across thylakoid membranes .

Key Functional Domains:

  • Transmembrane helices: Critical for proton channel formation.

  • Conserved residues: Facilitate interactions with other F₀ subunits (e.g., subunit b and c) .

Amino Acid Sequence:

The full-length sequence (1-247aa) is:
MNVLSYSINTLEGLYEISGVEVGQHFYWKIGGFQVHAQVLITSWVVIVILLGSAIVTVRNPQTIPTDGQNFFEYILEFIRDVSKTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWKIIELPHGELAAPTNDINTTVALALLTSIAYFYAGLSKKGLGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH .

Production and Quality Control

The recombinant atpI is synthesized using codon-optimized E. coli expression systems to ensure high yield and solubility .

Table 2: Production Protocols

StepProtocol Details
ExpressionInduced with IPTG; optimized for soluble protein production
PurificationImmobilized metal affinity chromatography (IMAC) via His tag
ReconstitutionDissolve in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for stability
StabilityAvoid repeated freeze-thaw cycles; working aliquots stable at 4°C for 7 days

Limitations and Future Directions

  • Functional assays: No in vitro enzymatic activity data are reported in current sources .

  • Species-specificity: Structural differences between poplar and model organisms (e.g., Arabidopsis) may limit extrapolation .

  • Industrial potential: Requires integration with metabolic engineering efforts, such as enhancing PCB detoxification pathways in transgenic poplars .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Populus alba (White poplar)
Target Names
atpI
Target Protein Sequence
MNVLSYSINTLEGLYEISGVEVGQHFYWKIGGFQVHAQVLITSWVVIVILLGSAIVTVRN PQTIPTDGQNFFEYILEFIRDVSKTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWKII ELPHGELAAPTNDINTTVALALLTSIAYFYAGLSKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function

Key component of the proton channel; it plays a crucial role in proton translocation across the membrane.

Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit a, chloroplastic (atpI) in Populus alba?

ATP synthase subunit a (atpI) is an integral membrane protein component of the F0 sector of the chloroplast ATP synthase complex. In Populus alba (White poplar), this protein is embedded in the thylakoid membrane and plays a crucial role in proton translocation during ATP synthesis. The atpI gene encodes a 247-amino acid protein that functions as part of the proton channel within the F0 sector .

The protein is also known as "ATP synthase F0 sector subunit a" or "F-ATPase subunit IV" and is essential for the proper functioning of the entire ATP synthase complex, which generates ATP required for photosynthetic metabolism . This subunit works in concert with other components of the ATP synthase complex to harness the proton motive force (pmf) generated during the light reactions of photosynthesis.

How does atpI interact with other subunits in the ATP synthase complex?

The atpI subunit functions as part of the membrane-embedded F0 sector of ATP synthase, which in chloroplasts typically has a subunit composition of abb'c13-15 . AtpI interacts closely with the c-ring (c13-15), forming a crucial component of the proton channel. The rotation of this c-ring is mechanically coupled to the synthesis of ATP in the F1 sector of the complex.

The protein forms specific interactions with adjacent subunits, particularly subunits b and b', which connect the membrane-embedded F0 sector to the catalytic F1 sector. This organization enables the efficient conversion of the proton motive force into rotational movement and, subsequently, ATP synthesis. In chloroplast ATP synthase, the interface between subunit a and the c-ring is particularly important for proton translocation, as it contains the half-channels through which protons enter and exit .

What expression systems are most effective for recombinant production of atpI?

Based on research with similar chloroplast proteins, the most effective expression systems for recombinant production of atpI include:

  • E. coli expression systems: These can be optimized using specialized vectors containing strong promoters (T7, tac) coupled with appropriate fusion tags to enhance protein stability and solubility. For membrane proteins like atpI, E. coli strains such as C41(DE3) or C43(DE3), which are specifically designed for membrane protein expression, often yield better results .

  • Chloroplast transformation systems: For functional studies, chloroplast transformation vectors can provide an authentic environment for atpI expression. Systems developed for plants like Nicotiana benthamiana offer a versatile platform for recombinant chloroplast protein expression . These systems typically employ homologous recombination to integrate transgenes into the chloroplast genome, resulting in significantly higher expression levels compared to nuclear transformation.

  • Cell-free expression systems: These can be valuable for producing membrane proteins like atpI without the potential toxicity issues associated with overexpression in living cells.

The choice of expression system should be guided by the specific research objectives, such as structural studies, functional assays, or protein-protein interaction analyses.

What purification strategies yield the highest purity and functional integrity of recombinant atpI?

Purification of recombinant atpI requires specialized approaches due to its membrane-embedded nature:

  • Detergent-based extraction: Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin can effectively solubilize atpI while maintaining its structural integrity.

  • Affinity chromatography: Fusion tags such as maltose-binding protein (MBP), histidine tags, or strep tags facilitate purification while potentially enhancing protein solubility . For instance, the MBP tag has been successfully employed in purifying the c subunit of chloroplast ATP synthase, and similar approaches can be adapted for atpI.

  • Size exclusion chromatography: This serves as a critical polishing step to separate properly folded protein from aggregates and to exchange detergents if necessary.

A typical purification protocol might include:

  • Membrane fraction isolation from expression host

  • Detergent solubilization (optimized detergent:protein ratio)

  • Affinity chromatography using appropriate fusion tags

  • Optional on-column detergent exchange

  • Size exclusion chromatography

  • Quality assessment through circular dichroism spectroscopy to confirm secondary structure

For functional studies, it's essential to maintain the native alpha-helical secondary structure, which can be verified using circular dichroism spectroscopy as demonstrated with other ATP synthase subunits .

How can researchers verify the structural integrity of purified recombinant atpI?

Several complementary techniques can be employed to verify the structural integrity of purified recombinant atpI:

  • Circular Dichroism (CD) Spectroscopy: This technique can confirm the alpha-helical secondary structure that is characteristic of atpI. The expected CD spectrum should show negative bands at 208 and 222 nm, indicative of alpha-helical content .

  • Fourier Transform Infrared Spectroscopy (FTIR): Provides complementary information on secondary structure elements.

  • Limited Proteolysis: Can be used to assess whether the protein is properly folded, as properly folded proteins typically show distinctive proteolytic patterns.

  • Mass Spectrometry: Used to confirm the protein identity and detect any post-translational modifications.

  • Fluorescence Spectroscopy: If the protein contains tryptophan residues, their fluorescence emission can provide information about the local environment and folding state.

  • Size Exclusion Chromatography coupled with Multi-Angle Light Scattering (SEC-MALS): This can determine whether the protein exists as a monomer, forms oligomers, or aggregates.

Structural integrity should be assessed under conditions that mimic the native membrane environment, possibly using nanodiscs or liposomes for reconstitution.

What methods can be used to study the proton translocation function of recombinant atpI?

Studying proton translocation through atpI requires sophisticated biophysical techniques:

  • Reconstitution in liposomes: Purified atpI can be reconstituted into liposomes containing pH-sensitive fluorescent dyes (such as ACMA or pyranine) to monitor proton movement across the membrane.

  • Patch-clamp electrophysiology: This technique can directly measure proton currents through reconstituted atpI or ATP synthase complexes.

  • Solid-state NMR spectroscopy: This approach can provide atomic-level insights into the proton translocation pathway and conformational changes associated with proton movement.

  • Site-directed mutagenesis: Strategic mutations of conserved residues predicted to be involved in proton translocation, followed by functional assays, can reveal the mechanistic details of proton movement .

  • Hydrogen/deuterium exchange mass spectrometry (HDX-MS): This method can identify regions of the protein that are accessible to solvent and potentially involved in proton transfer.

These methods should be complemented with computational approaches such as molecular dynamics simulations to fully understand the proton translocation mechanism.

How can researchers engineer the c-ring stoichiometry in chloroplast ATP synthase?

Engineering the c-ring stoichiometry in chloroplast ATP synthase represents an advanced research challenge with significant implications for energy conversion efficiency:

  • Site-directed mutagenesis: Strategic mutations at the interface between adjacent c-subunits can alter the ring curvature and potentially influence stoichiometry .

  • Heterologous expression systems: Recombinant expression of atpI along with modified c-subunits can be used to test the influence of specific interactions on ring assembly .

  • Directed evolution approaches: Creating libraries of c-subunit variants and selecting for altered assembly properties.

  • Chimeric constructs: Creating hybrid proteins with segments from species with different c-ring stoichiometries to identify determinants of ring size.

The challenge in engineering c-ring stoichiometry lies in understanding the complex interplay between subunit interactions and membrane environment. Research on the spinach chloroplast ATP synthase c-subunit has shown that recombinant expression systems can enable molecular biology techniques that cannot be applied to native c-rings, potentially allowing for manipulation of stoichiometry .

What techniques can be used to study the assembly of recombinant atpI into functional ATP synthase complexes?

Studying the assembly of atpI into functional ATP synthase complexes requires methods that can track protein-protein interactions and complex formation:

  • Blue native PAGE: This technique can separate intact membrane protein complexes and identify subcomplexes that form during assembly.

  • Crosslinking coupled with mass spectrometry: This approach can identify specific interaction sites between atpI and other subunits during complex assembly.

  • Förster Resonance Energy Transfer (FRET): By labeling different subunits with fluorescent tags, FRET can monitor proximity and interactions during assembly.

  • Single-particle cryo-electron microscopy: This technique can visualize assembled complexes and potential assembly intermediates.

  • In vitro reconstitution assays: Purified components can be combined to reconstitute functional ATP synthase complexes, with activity measurements confirming successful assembly.

  • Pulse-chase experiments: These can track the kinetics of assembly in cellular systems expressing recombinant components.

Understanding the assembly pathway is crucial for functional studies, as proper assembly is a prerequisite for ATP synthase activity.

How can chloroplast transformation vectors be designed for efficient expression of atpI?

Designing effective chloroplast transformation vectors for atpI expression requires careful consideration of several factors:

  • Homologous recombination regions: Vectors should include flanking sequences homologous to the chloroplast genome target site to facilitate precise integration through homologous recombination .

  • Strong chloroplast promoters: Promoters such as the psbA or rrn promoter can drive high expression levels in chloroplasts.

  • 5' and 3' untranslated regions (UTRs): These elements from highly expressed chloroplast genes enhance mRNA stability and translation efficiency.

  • Selectable marker: Typically, the aadA gene conferring spectinomycin/streptomycin resistance is used for selection of transplastomic plants .

  • Codon optimization: Adapting the coding sequence to match the codon usage preferences of the chloroplast genome.

The 2-part vector system developed for chloroplast transformation in N. benthamiana provides a versatile platform that could be adapted for atpI expression . This system streamlines the construction process of chloroplast transformation vectors, potentially enabling more efficient expression of recombinant proteins like atpI in chloroplasts.

What are the key parameters for optimizing particle bombardment in chloroplast transformation with atpI?

When using particle bombardment for chloroplast transformation with atpI-containing vectors, several parameters must be optimized:

  • Particle type and size: Gold particles (0.6-1.0 μm) are typically more effective than tungsten for chloroplast transformation.

  • DNA coating method: Precipitation of DNA onto particles using calcium chloride and spermidine should be optimized for maximum DNA loading.

  • Acceleration pressure: This should be carefully calibrated to deliver particles to the chloroplast without excessive damage to the target tissue .

  • Target tissue distance: The distance between the stopping screen and target tissue affects particle velocity and penetration.

  • Vacuum level: Proper vacuum levels are necessary for consistent particle delivery.

  • Target tissue selection: Young, actively growing leaves or callus tissue often yield better transformation rates.

Research has shown that minimizing excessive damage to target tissue is crucial for the recovery of antibiotic-resistant shoots and calli following transformation . This is particularly important when working with genes like atpI that are involved in essential energy metabolism pathways.

How can statistical optimization improve the purification of recombinant atpI?

Statistical optimization approaches, such as Design of Experiments (DoE), can significantly improve the purification efficiency of recombinant atpI:

A typical experimental design matrix for optimizing atpI purification might look similar to this:

RunFactor 1: Detergent Conc.Factor 2: Salt Conc.Factor 3: pHFactor 4: TemperatureResponse: Protein Purity
1LowLowLowLowMeasured
2HighLowLowLowMeasured
..................
30MediumMediumMediumMediumMeasured

Analysis of variance (ANOVA) can then be used to determine which factors significantly affect purification efficiency and to model the relationships between variables . Regression analysis using a second-order polynomial equation can be particularly effective:

Y = β₀ + Σβᵢxᵢ + Σβᵢᵢxᵢ² + ΣΣβᵢⱼxᵢxⱼ

Where Y is the predicted output (protein purity), β₀ is the intercept coefficient, βᵢ are linear coefficients, βᵢᵢ are quadratic coefficients, and βᵢⱼ are interaction coefficients .

How does atpI from Populus alba compare structurally and functionally to homologs in other plant species?

Comparative analysis of atpI across plant species reveals both conserved features and species-specific adaptations:

Bioinformatic tools such as multiple sequence alignment, homology modeling, and evolutionary analysis can reveal how atpI has evolved across the green lineage to optimize ATP synthesis under diverse environmental conditions.

What are the prospects for engineering atpI to enhance photosynthetic efficiency?

Engineering atpI presents several intriguing possibilities for enhancing photosynthetic efficiency:

Advanced genetic manipulation and protein design tools are expected to significantly expand the scope for testing these engineering strategies in the future . Combining structural biology insights with directed evolution approaches represents a promising direction for creating optimized variants of atpI.

How can systems biology approaches improve our understanding of atpI function in the context of whole-plant physiology?

Systems biology approaches offer powerful frameworks for understanding atpI function in broader physiological contexts:

These approaches can help identify potential bottlenecks in photosynthetic efficiency that might be addressed through strategic engineering of atpI or other ATP synthase components . Future research should focus on developing integrative models that can predict how molecular modifications will affect plant performance under field conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.