Recombinant Populus alba Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Populus alba (White poplar)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTVVALWLGIGATLPIDKSLTLGLFQIDSI
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the cytochrome b6-f complex and what role does subunit 4 play?

The cytochrome b6-f complex is a key component of the photosynthetic electron transport chain, consisting of four protein subunits including cytochrome f, cytochrome b6, the Rieske Fe-S protein, and subunit IV (encoded by the petD gene). In the complex, subunit IV works in conjunction with the other components to facilitate electron transfer between photosystems II and I. The petD gene is located in the chloroplast genome and undergoes specific processing before translation . In Populus alba, as in other plant species, this complex is essential for energy conversion during photosynthesis.

How is petD gene expression regulated in Populus alba?

The petD gene in Populus alba, like other chloroplast genes for the cytochrome b6-f complex components, is transcribed within the chloroplast. The transcript undergoes specific processing events including splicing and RNA editing. Studies have shown that the petD transcript undergoes normal processing in plants, and this processing is essential for proper expression . Regulation may be affected by environmental factors such as light intensity, temperature, and developmental stage of the plant tissue, though specific regulatory mechanisms in Populus alba would require targeted investigation using techniques such as RNA gel blot analyses and polysomal RNA studies.

What are the basic methods for isolating the petD gene from Populus alba?

Isolation of the petD gene from Populus alba typically involves:

  • Collection of fresh leaf tissue from Populus alba specimens

  • RNA extraction using specialized reagents (e.g., Beyozol reagent)

  • cDNA synthesis using first-strand synthesis kits

  • PCR amplification with petD-specific primers designed from conserved regions

  • Cloning of PCR products into appropriate vectors (such as pMD18-T)

  • Transformation into competent E. coli cells

  • Colony screening and sequence verification

This approach allows for the isolation of the complete coding sequence, which can then be used for further molecular analyses or recombinant expression.

Which expression systems are most suitable for recombinant Populus alba petD production?

For recombinant expression of Populus alba petD, several systems can be considered, each with distinct advantages:

Expression SystemAdvantagesLimitationsSpecial Considerations
E. coliRapid growth, high yield, simple manipulationLacks post-translational modifications, inclusion body formationCodon optimization may be required; membrane protein expression challenging
Yeast (S. cerevisiae)Eukaryotic system, some post-translational modificationsLower yield than E. coliEffective for co-expression studies with electron transport partners
Insect cellsAdvanced eukaryotic modificationsMore complex, expensiveGood for functional studies requiring proper folding
Plant-based systemsNative-like environment, appropriate modificationsSlower growth, lower yieldHomologous expression may provide most authentic protein

For functional studies involving electron transport activity, yeast systems have proven effective, particularly when co-expressing cytochrome b6-f components with their electron transport partners .

What are the key considerations for optimizing codon usage in recombinant petD expression?

When expressing Populus alba petD in heterologous systems, codon optimization is crucial due to species-specific codon preferences. Key considerations include:

  • Analysis of the Populus alba codon usage bias versus the expression host

  • Adjustment of rare codons to match the host's preferred codons without altering the amino acid sequence

  • Optimization of GC content to improve mRNA stability and translation efficiency

  • Removal of potential mRNA secondary structures that might impede translation

  • Elimination of cryptic splice sites, particularly when expressing in eukaryotic systems

  • Preservation of critical regulatory sequences that might affect protein folding kinetics

Codon optimization typically improves expression yields by 5-15 fold, but requires careful design to maintain protein functionality, particularly for membrane-associated proteins like subunit IV.

What are the most effective methods for purifying recombinant Populus alba petD protein?

Purification of recombinant Populus alba petD (subunit IV) presents unique challenges due to its hydrophobic nature and membrane association. An effective purification strategy includes:

  • Selection of appropriate detergents for membrane solubilization (e.g., n-dodecyl-β-D-maltoside or digitonin)

  • Affinity chromatography using tags (His, Strep, or FLAG) fused to the recombinant protein

  • Size exclusion chromatography to separate monomeric from aggregated forms

  • Ion exchange chromatography for final polishing steps

The choice of purification method depends on the experimental goals - structural studies require higher purity than functional assays. Maintaining the native conformation during purification is critical for functional studies, often necessitating milder detergents and inclusion of lipids during purification.

How can researchers assess the structural integrity of purified recombinant petD protein?

Multiple complementary approaches should be employed to verify the structural integrity of purified recombinant petD protein:

  • Circular dichroism (CD) spectroscopy to analyze secondary structure content

  • Thermal shift assays to assess protein stability under various conditions

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to determine oligomeric state

  • Limited proteolysis to probe for correctly folded domains

  • Intrinsic fluorescence spectroscopy to examine tertiary structure

  • Computational structure prediction using tools such as AlphaFold2.0

These methods provide a comprehensive assessment of protein folding quality, which is particularly important for membrane proteins like subunit IV that are prone to misfolding when expressed recombinantly.

What methods are available for assessing the functional activity of recombinant petD protein?

Functional characterization of recombinant Populus alba petD requires assays that measure its integration into the cytochrome b6-f complex and subsequent electron transport activity:

  • Reconstitution assays with other purified components of the cytochrome b6-f complex

  • Electron transport measurements using artificial electron donors and acceptors

  • Cytochrome c reduction assays (similar to those used for cytochrome P450 reductases)

  • Proteoliposome reconstitution to measure proton translocation activity

  • Co-expression with partner proteins in heterologous systems followed by activity measurements

  • In vitro translation and membrane insertion assays to assess proper integration

When designing these assays, it's essential to include appropriate positive and negative controls, as well as to verify the specificity of the measured activity through inhibitor studies or by using inactive mutant forms of the protein.

How can researchers investigate protein-protein interactions involving Populus alba petD?

Several techniques are available for investigating interactions between subunit IV (petD) and other components of the cytochrome b6-f complex:

  • Co-immunoprecipitation using antibodies against subunit IV or potential interacting partners

  • Bimolecular fluorescence complementation (BiFC) for in vivo interaction studies

  • Surface plasmon resonance (SPR) for quantitative binding kinetics

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

  • Cross-linking coupled with mass spectrometry to identify interaction sites

  • Yeast two-hybrid or split-ubiquitin systems for membrane protein interactions

For membrane proteins like subunit IV, modifications to standard protocols are often necessary. The split-ubiquitin system is particularly useful as it allows detection of interactions between membrane-associated proteins. When studying the assembly of the complete cytochrome b6-f complex, a stepwise approach is recommended, examining binary interactions before attempting to reconstruct the full complex.

How do mutations in the petD gene affect cytochrome b6-f complex stability and function?

Research has shown that mutations in petD can significantly impact the assembly and function of the cytochrome b6-f complex. Key findings include:

  • Some mutations lead to increased protein turnover rates of subunit IV, as observed in mutant studies

  • Specific mutations can affect the binding of plastoquinone, a key substrate for the complex

  • Structural mutations may destabilize the complex, leading to reduced accumulation in thylakoid membranes

  • Regulatory mutations may alter the processing of petD transcripts, affecting expression levels

When studying mutations in Populus alba petD, researchers should employ a combination of approaches including site-directed mutagenesis, heterologous expression, protein stability assays, and functional measurements to comprehensively characterize the effects of specific amino acid changes on complex assembly and function.

What are the challenges in comparing petD gene expression and function across different Populus species?

Comparative studies of petD across Populus species present several challenges:

  • Genetic diversity within the genus Populus requires careful selection of representative specimens

  • Differences in growth conditions can significantly affect gene expression patterns

  • Species-specific post-transcriptional processing may affect mRNA stability and translation efficiency

  • Protein sequence variations, even minor ones, may alter subunit IV function or stability

  • Different Populus species show varying ease of vegetative propagation, affecting experimental design

When designing comparative studies, researchers should standardize growth conditions, sampling protocols, and analytical methods. Molecular techniques like AFLP (Amplified Fragments Length Polymorphism) have proven useful for accurately identifying different Populus clones , which is essential for ensuring experimental reproducibility across studies of different species.

How can CRISPR-Cas9 technology be applied to study petD function in Populus alba?

CRISPR-Cas9 technology offers powerful approaches for studying petD function in Populus alba:

  • Generation of knockout mutants to assess the essentiality of specific protein domains

  • Creation of precise point mutations to study structure-function relationships

  • Introduction of epitope tags for protein localization and interaction studies

  • Development of conditional knockout systems for studying essential genes

  • Promoter modifications to alter expression levels

When applying CRISPR-Cas9 to chloroplast genes like petD, specialized approaches are required since standard nuclear CRISPR methods don't directly modify the chloroplast genome. Researchers must either:

  • Target nuclear factors that regulate chloroplast gene expression

  • Employ chloroplast-specific transformation techniques

  • Use transplastomic approaches where the editing machinery is targeted to the chloroplast

The relatively difficult vegetative propagation of Populus alba (with >80% of cuttings failing to grow) presents additional challenges for generating transformed lines, potentially requiring optimization of tissue culture conditions.

How does petD gene expression in Populus alba correlate with environmental stress responses?

The expression of photosynthetic genes, including petD, often responds to environmental stressors. While specific data for Populus alba petD is limited, general patterns suggest:

To study these correlations in Populus alba specifically, researchers should employ:

  • Time-course RNA sampling under controlled stress conditions

  • RT-qPCR to quantify transcript levels

  • Western blotting to measure protein abundance

  • Electron transport measurements to assess functional impacts

  • Transcriptome analysis to place petD regulation in a broader context

What bioinformatic approaches are most useful for studying petD evolution across plant species?

Several bioinformatic approaches provide valuable insights into petD evolution:

  • Multiple sequence alignment to identify conserved domains and variable regions

  • Phylogenetic analysis to reconstruct evolutionary relationships

  • Selection analysis (dN/dS ratios) to identify sites under positive or purifying selection

  • Coevolution analysis to detect correlated mutations between interacting proteins

  • Ancestral sequence reconstruction to infer evolutionary trajectories

  • Structural modeling to map sequence variation onto protein structure

These approaches can reveal how the petD gene has evolved within the Populus genus and more broadly across plant species. Phylogenetic analysis has already proven useful in classifying Populus species into sections (Aigeiros, Tacamahaca, Leuce) , providing an evolutionary framework for understanding petD variations. Advanced structural prediction tools like AlphaFold2.0 can help visualize how sequence differences might impact protein function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.