Recombinant Populus alba Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Populus alba Cytochrome b6 (petB)

Recombinant Populus alba Cytochrome b6 (petB) is a genetically engineered protein derived from the cytochrome b6 subunit of the cytochrome b₆f complex in white poplar (Populus alba). This complex plays a critical role in photosynthetic electron transport, facilitating both linear and cyclic electron flow in chloroplasts . The recombinant variant is produced in Escherichia coli with an N-terminal His tag for purification and research applications .

Key Features

  • Molecular composition: Full-length protein (1-215 amino acids; UniProt ID: Q14FC7) .

  • Tag: N-terminal polyhistidine (His) tag for affinity chromatography .

  • Molecular weight: Calculated based on sequence (~24 kDa), but observed variations may occur due to post-translational modifications .

Functional Role in Photosynthesis

Cytochrome b6 is integral to the cytochrome b₆f complex, which catalyzes:

  1. Plastoquinol oxidation at the lumenal side .

  2. Proton translocation across thylakoid membranes, contributing to the proton-motive force (pmf) for ATP synthesis .

  3. Redox sensing to regulate energy distribution between Photosystem I (PSI) and Photosystem II (PSII) .

Expression System

  • Host: E. coli .

  • Purification: Immobilized metal-affinity chromatography (IMAC) via His tag .

Key Uses

  1. Structural studies: Investigating dimerization and subunit interactions in the cytochrome b₆f complex .

  2. Enzyme kinetics: Analyzing electron transfer mechanisms and plastoquinone binding .

  3. Biotechnological engineering: Modifying photosynthetic efficiency in plants .

Case Study: Stability of Cytochrome b₆f Complex

Deletion of low-molecular-weight subunits (e.g., PetL, PetG, PetN) in tobacco disrupts cytochrome b₆f dimerization and reduces Rieske protein stability . While this study focused on Nicotiana tabacum, it provides insights applicable to Populus homologs .

Challenges and Future Directions

  • Limitations: No direct studies on Populus alba’s recombinant petB exist; functional inferences rely on homologs .

  • Opportunities:

    • Engineering thermostable variants for industrial applications .

    • Integration with synthetic biology platforms to enhance photosynthetic pathways .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for the most accurate delivery timeframe.
All protein shipments are sent with standard blue ice packs. If dry ice packaging is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing should be avoided. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a guideline.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Repeated freeze-thaw cycles should be minimized.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Populus alba (White poplar)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQTIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 (petB) is a crucial component of the cytochrome b6-f complex. This complex plays a vital role in electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Populus alba Cytochrome b6 (petB) and what is its biological significance?

Cytochrome b6 (petB) is an essential protein component of the cytochrome b6f complex, which plays a critical role in the electron transport chain of photosynthesis in Populus alba (White poplar). This protein is encoded by the petB gene and consists of 215 amino acids in its full-length form . The protein functions as an integral membrane protein in the thylakoid membrane, facilitating electron transfer between photosystem II and photosystem I during photosynthesis. Understanding this protein is crucial for research on photosynthetic mechanisms, plant energy metabolism, and evolutionary adaptations in the Populus genus .

How is recombinant Populus alba Cytochrome b6 (petB) typically produced for research applications?

Recombinant Populus alba Cytochrome b6 (petB) is typically produced using Escherichia coli expression systems. The process involves cloning the full-length petB gene sequence (encoding amino acids 1-215) from Populus alba into an expression vector with an N-terminal His-tag for purification purposes . After transformation into E. coli, the bacteria are cultured under optimized conditions to express the protein. Following expression, the protein is extracted and purified using affinity chromatography techniques that utilize the His-tag. The purified protein is then typically lyophilized into a powder form with greater than 90% purity as determined by SDS-PAGE analysis .

What are the optimal storage and reconstitution conditions for recombinant Populus alba Cytochrome b6 (petB)?

For optimal storage and handling of recombinant Populus alba Cytochrome b6 (petB):

  • Upon receipt, the lyophilized protein should be stored at -20°C/-80°C.

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles.

  • Working aliquots can be stored at 4°C for up to one week .

  • For reconstitution:

    • Briefly centrifuge the vial before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration between 5-50% (typically 50% is recommended)

    • Aliquot for long-term storage at -20°C/-80°C

The protein is typically supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during storage .

What are the recommended experimental controls when working with recombinant Populus alba Cytochrome b6 (petB) in functional assays?

When designing experiments with recombinant Populus alba Cytochrome b6 (petB), researchers should implement the following controls:

  • Negative Controls:

    • Empty vector-expressed protein preparation to account for any E. coli contaminants

    • Heat-denatured Cytochrome b6 to verify activity is protein-specific

    • Buffer-only samples to establish baseline measurements

  • Positive Controls:

    • Known functional homologs such as Prochlorothrix hollandica Cytochrome b6

    • Native (non-recombinant) Cytochrome b6 isolated from Populus alba chloroplasts

  • Reference Standards:

    • Commercial cytochrome preparations with established activity levels

    • Standardized electron transport assays with known kinetics

For in vitro functional assays, it's crucial to validate protein activity by monitoring electron transfer using spectrophotometric techniques, measuring absorbance changes at relevant wavelengths (typically 552-563 nm for cytochromes). Additionally, researchers should consider the impact of the His-tag on protein function, potentially comparing tagged versus enzymatically cleaved versions of the protein .

How can researchers distinguish between native and recombinant Populus alba Cytochrome b6 (petB) in experimental systems?

Distinguishing between native and recombinant Populus alba Cytochrome b6 (petB) can be accomplished through several complementary approaches:

  • Molecular Weight Analysis:

    • The recombinant protein contains an N-terminal His-tag, resulting in a slightly higher molecular weight compared to the native protein

    • SDS-PAGE analysis can reveal this size difference

    • Western blotting with tag-specific antibodies will only detect the recombinant form

  • Epitope Detection:

    • Anti-His antibodies specifically bind to the His-tag present only in the recombinant protein

    • Immunoprecipitation using anti-His antibodies can selectively isolate the recombinant form

  • Sequence Verification:

    • Mass spectrometry can identify tag-specific peptides in tryptic digests

    • N-terminal sequencing will reveal the presence of His-tag residues in the recombinant protein

  • Post-translational Modification Analysis:

    • Native proteins may contain specific post-translational modifications absent in E. coli-expressed recombinant proteins

    • Phosphorylation, glycosylation, or other modifications can be assessed by specialized staining or mass spectrometry

When conducting experiments with mixed samples, researchers can use immunodepletion with anti-His antibodies to selectively remove the recombinant protein, allowing for comparison of system behavior with and without the added recombinant component .

What methods are most effective for analyzing protein-protein interactions involving Populus alba Cytochrome b6 (petB)?

For investigating protein-protein interactions involving Populus alba Cytochrome b6 (petB), researchers should consider these methodological approaches:

  • Co-immunoprecipitation (Co-IP):

    • Utilize the His-tag for pull-down experiments with Ni-NTA resin

    • Analyze co-precipitated proteins by mass spectrometry

    • Western blotting with antibodies against suspected interacting partners

  • Bimolecular Fluorescence Complementation (BiFC):

    • Express petB fused to one half of a fluorescent protein (e.g., YFP) in plant cells

    • Express candidate interacting proteins fused to the complementary half

    • Monitor reconstitution of fluorescence using confocal microscopy

  • Surface Plasmon Resonance (SPR):

    • Immobilize His-tagged Cytochrome b6 on a sensor chip

    • Flow potential binding partners over the surface

    • Measure binding kinetics and affinity constants

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Compare deuterium uptake patterns of Cytochrome b6 alone versus in complex with binding partners

    • Map interaction interfaces with peptide-level resolution

  • Crosslinking Mass Spectrometry:

    • Use chemical crosslinkers to stabilize transient interactions

    • Identify crosslinked peptides by mass spectrometry

    • Generate distance restraints for structural modeling

When working with membrane proteins like Cytochrome b6, it's essential to maintain an appropriate lipid environment or use suitable detergents to preserve native protein conformation and interaction capabilities .

How do sequence variations in petB genes from different Populus alba populations affect protein function and structure?

Analysis of petB gene sequences from different Populus alba populations reveals important structure-function relationships:

  • Population-Specific Sequence Variations:

    • Studies of Populus alba from Sardinia reveal unique haplotypes at the chloroplast DNA (cpDNA) level compared to mainland populations

    • Despite this uniqueness, the core functional domains of Cytochrome b6 remain highly conserved

  • Functional Impact Assessment:

    • Comparative analysis of conserved versus variable regions provides insight into essential functional domains

    • Transmembrane helices and cofactor binding sites show highest conservation

    • Variable regions typically occur in loop regions facing the stromal side

  • Structural Consequences:

    • Homology modeling based on crystal structures of Cytochrome b6 from other species can predict the impact of population-specific variations

    • Most substitutions appear to be functionally neutral or compensatory

  • Evolutionary Significance:

    • Island populations like those in Sardinia show unique genetic signatures, potentially representing relict populations with distinct evolutionary histories

    • These population-specific variants may represent adaptations to local environmental conditions

The amino acid sequence of Populus alba Cytochrome b6 (1-215 aa) reveals the core structure necessary for function, with critical residues involved in heme binding and electron transfer being invariant across populations . Researchers investigating population-specific variants should focus on expression level differences and subtle functional variations that might confer adaptive advantages.

What are the experimental challenges in comparing recombinant Cytochrome b6 from different Populus species and how can they be addressed?

Researchers face several challenges when comparing recombinant Cytochrome b6 from different Populus species:

  • Expression Efficiency Variations:

    • Different species' sequences may have codon usage incompatible with E. coli

    • Solution: Optimize codon usage or use specialized expression strains

  • Protein Stability Differences:

    • Sequence variations may affect protein folding and stability

    • Solution: Screen multiple buffer conditions using differential scanning fluorimetry

  • Post-translational Modification Discrepancies:

    • E. coli cannot reproduce plant-specific modifications

    • Solution: Consider eukaryotic expression systems (yeast, insect cells) for crucial comparisons

  • Functional Assay Standardization:

    • Different protein preparations may have varying activity levels

    • Solution: Normalize activity to protein concentration and use internal standards

  • Structural Heterogeneity:

    • Membrane proteins often adopt multiple conformations

    • Solution: Use size-exclusion chromatography to isolate homogeneous populations

Recommended Comparative Approach:

  • Express all variants under identical conditions

  • Purify using standardized protocols

  • Confirm proper folding using circular dichroism spectroscopy

  • Assess thermal stability profiles

  • Compare electron transfer rates under standardized conditions

  • Analyze binding affinities for interaction partners

When comparing Populus alba Cytochrome b6 (215 aa) with other species such as the Prochlorothrix hollandica variant (222 aa) , researchers should account for both length differences and sequence variations that may impact structural stability and function.

How does the genetic diversity of Populus alba populations influence the characteristics of recombinant Cytochrome b6 production?

The genetic diversity of Populus alba populations has significant implications for recombinant Cytochrome b6 production and research:

  • Source Population Selection Considerations:

    • Island populations (e.g., Sardinia) show unique haplotypes at the chloroplast DNA level

    • Despite low genetic diversity at the cpDNA level in Sardinian populations (vK = 0.15), nuclear genetic diversity remains comparable to mainland populations (HT = 0.60)

    • This genetic diversity pattern affects which population should be selected as the source material

  • Clonal Structure Impact:

    • Sardinian populations consist of few genets with many ramets, forming extensive monoclonal stands

    • Four monoclonal stands in Sardinia range from 38.6 mile² (100 km²) to over 1,500 mile² (4,000 km²)

    • This clonal structure allows researchers to obtain genetically identical source material over large geographical areas

  • Hybridization Considerations:

    • Natural hybridization occurs between P. alba and other Populus species (P. grandidentata, P. tremuloides)

    • Researchers must verify the genetic purity of source material when isolating petB genes

    • PCR-based markers can distinguish pure P. alba from hybrid material

  • Genetic Authentication Table:

Population TypeGenetic Diversity CharacteristicsVerification MethodSuitability for Research
Continental populationsHigher genetic diversity, both genders presentNuclear SSR markersIdeal for studying natural variation
Island populations (Sardinia)Low cpDNA diversity (vK = 0.15), often single-sex standscpDNA haplotypingBest for standardized production
Hybrid zonesMixed genetic backgroundSpecies-specific markersCaution required, may introduce variability
  • Recommendation for Standardized Production:

    • Select source material from well-characterized populations

    • Verify genetic identity before gene cloning

    • Maintain reference samples for future authentication

    • Consider the impact of source population on protein characteristics

The unique genetic structure of Populus alba populations, particularly the prevalence of extensive clonal reproduction in Sardinian populations, provides both opportunities and challenges for researchers working with recombinant proteins .

How can recombinant Populus alba Cytochrome b6 (petB) be utilized in photosynthesis research?

Recombinant Populus alba Cytochrome b6 (petB) offers valuable research tools for advancing photosynthesis research:

  • Reconstitution Experiments:

    • Incorporation into artificial membrane systems (liposomes or nanodiscs)

    • Reconstruction of partial or complete electron transport chains

    • Study of electron transfer kinetics in controlled environments

  • Structure-Function Analysis:

    • Site-directed mutagenesis of specific residues to assess their role in electron transfer

    • Identification of critical amino acids for quinol binding and oxidation

    • Investigation of how specific domains contribute to supercomplex formation

  • Comparative Studies:

    • Analysis of functional differences between Populus alba Cytochrome b6 and homologs from other photosynthetic organisms

    • Correlation of sequence variations with functional adaptations to different environmental conditions

    • Evaluation of the 215-amino acid sequence from Populus alba compared to the 222-amino acid sequence from other species like Prochlorothrix hollandica

  • Experimental Applications:

    • Use as a standard in quantitative proteomic analyses of photosynthetic complexes

    • Development of antibodies against specific epitopes for immunolocalization studies

    • Creation of fluorescently labeled derivatives for tracking protein dynamics

  • Integration with Emerging Technologies:

    • Incorporation into synthetic biology approaches for enhanced photosynthesis

    • Combination with cryo-electron microscopy for high-resolution structural studies

    • Application in optogenetic systems for light-controlled electron transfer

The availability of highly purified recombinant protein (>90% purity by SDS-PAGE) enables precise manipulation and measurement of Cytochrome b6 properties outside the complex cellular environment, allowing researchers to isolate specific aspects of photosynthetic electron transport.

What insights can comparative analysis of Populus alba Cytochrome b6 provide about evolutionary adaptations in tree species?

Comparative analysis of Populus alba Cytochrome b6 offers valuable insights into evolutionary adaptations:

  • Phylogeographic Patterns:

    • The unique haplotypes found in Sardinian populations suggest long-term isolation and independent evolution

    • These isolated populations represent natural experiments in adaptive evolution

    • Comparison of mainland and island variants reveals selection pressures on photosynthetic efficiency

  • Adaptive Evolution Signatures:

    • Analysis of non-synonymous to synonymous substitution ratios (dN/dS) can identify regions under selection

    • Conservation patterns differ between structural domains and functional interfaces

    • Comparison with Cytochrome b6 sequences from other Populus species can reveal genus-specific adaptations

  • Habitat-Specific Adaptations:

    • Populus alba is a thermophilic forest tree adapted to Mediterranean conditions

    • Sequence variations may reflect adaptations to temperature extremes, light intensity, or water availability

    • Comparison with species from different climatic regions can highlight environmentally-driven selection

  • Clonal Reproduction Implications:

    • The prevalence of clonal structures in Sardinian populations suggests that certain Cytochrome b6 variants may confer adaptive advantages

    • Long-lived clonal stands represent genotypes that have survived environmental challenges over extended periods

    • Analysis of these persistent genotypes may reveal functionally important sequence conservation

  • Hybridization Dynamics:

    • Natural hybridization between Populus species creates opportunities to study chimeric Cytochrome b6 variants

    • Hybrid performance may indicate the functional significance of species-specific sequence variations

    • Introgression patterns can reveal which sequence elements are under strongest selection

The comparative analysis of Cytochrome b6 variants, combined with the known ecological preferences and reproductive strategies of Populus alba populations, provides a powerful system for studying molecular evolution in a keystone forest tree species .

What are the methodological approaches for investigating the role of Populus alba Cytochrome b6 in stress responses?

Investigating the role of Populus alba Cytochrome b6 in stress responses requires multi-faceted methodological approaches:

  • Expression Analysis Under Stress Conditions:

    • qRT-PCR to measure petB transcript levels under different stresses (drought, high light, temperature)

    • Proteomic analysis to quantify protein abundance changes

    • Pulse-chase experiments to assess protein turnover rates during stress

  • Functional Characterization:

    • Electron transport measurements in isolated thylakoids under stress conditions

    • Comparison of recombinant wild-type versus stress-induced variant proteins

    • Reconstitution experiments with defined lipid compositions mimicking stress-altered membranes

  • Post-translational Modification Analysis:

    • Phosphoproteomics to identify stress-induced phosphorylation sites

    • Redox proteomics to detect oxidative modifications

    • Mass spectrometry to map all modifications and their dynamics during stress

  • Genetic Approaches:

    • Complementation of cytochrome b6 mutants with Populus alba variants

    • CRISPR-based editing to introduce specific mutations

    • Transgenic overexpression or knockdown to assess functional consequences

  • Advanced Imaging Techniques:

    • Fluorescence lifetime imaging microscopy (FLIM) to assess protein-protein interactions during stress

    • Super-resolution microscopy to visualize complex reorganization

    • FRAP (Fluorescence Recovery After Photobleaching) to measure mobility changes under stress

  • Experimental Design Considerations:

Stress TypeKey Parameters to MonitorRecommended TechniquesCritical Controls
High lightPhotoinhibition, ROS productionChlorophyll fluorescence, electron transport ratesDark-adapted samples
TemperatureMembrane fluidity, protein stabilityThermal shift assays, circular dichroismGradual vs. sudden temperature changes
DroughtElectron transport coupling, ATP synthesisP700 redox kinetics, electrochromic shiftControlled water potential
Salt stressIon homeostasis effects on electron flowSimultaneous K+, Na+ and electron transport measurementsOsmotic controls
  • Integration with Population-Level Data:

    • Correlation of sequence variations in petB with habitat characteristics

    • Field measurements of photosynthetic performance in different populations

    • Common garden experiments to separate genetic from environmental effects

The recombinant protein allows researchers to isolate specific biochemical aspects of stress responses, while population-level studies provide ecological context for interpreting molecular adaptations .

How can researchers validate the structural integrity and functional activity of purified recombinant Populus alba Cytochrome b6?

Comprehensive validation of recombinant Populus alba Cytochrome b6 requires multiple complementary approaches:

  • Structural Integrity Assessment:

    • SDS-PAGE Analysis: Verify size and purity (>90% as specified in product data)

    • Western Blotting: Confirm identity using anti-His tag and anti-Cytochrome b6 antibodies

    • Circular Dichroism (CD) Spectroscopy: Assess secondary structure content and proper folding

    • Thermal Shift Assays: Measure protein stability and melting temperature (Tm)

    • Size Exclusion Chromatography: Confirm monomeric state and absence of aggregation

  • Spectroscopic Characterization:

    • UV-Visible Spectroscopy: Verify characteristic absorption peaks for properly incorporated heme groups

    • Reduced vs. Oxidized Spectra: Confirm redox-dependent spectral shifts

    • Fluorescence Spectroscopy: Assess tertiary structure through intrinsic tryptophan fluorescence

  • Functional Activity Assays:

    • Electron Transfer Capacity: Measure kinetics using artificial electron donors/acceptors

    • Reconstitution Tests: Incorporate into liposomes and measure vectorial electron transport

    • Binding Assays: Verify interaction with physiological partners (plastocyanin, ferredoxin)

  • Validation Workflow:

Validation StepMethodExpected ResultTroubleshooting
Size verificationSDS-PAGESingle band at ~24 kDa (including His-tag)If multiple bands appear, optimize purification
Identity confirmationMass spectrometryPeptide matches to Populus alba Cytochrome b6 sequenceIf sequence coverage is low, try alternative digestion enzymes
Heme incorporationUV-Vis spectroscopySoret band (~410 nm) and Q-bands (520-560 nm)If peaks are absent, optimize expression with ALA supplementation
Redox activitySpectroelectrochemistryReversible spectral changes with potentialIf no changes occur, check buffer conditions and electrode setup
Partner bindingSurface plasmon resonanceSpecific binding to plastocyanin or plastoquinoneIf no binding, verify partner protein activity and buffer composition

For the Populus alba Cytochrome b6 protein with its 215-amino acid sequence , proper folding validation is particularly important given the complex membrane topology and cofactor requirements of this integral membrane protein.

What are the key considerations for designing site-directed mutagenesis experiments with Populus alba Cytochrome b6?

When designing site-directed mutagenesis experiments for Populus alba Cytochrome b6, researchers should consider:

  • Target Selection Strategy:

    • Conserved Residues: Identify amino acids conserved across species (comparing the 215 aa sequence from P. alba with homologs)

    • Functional Domains: Focus on heme-binding sites, quinone-binding pockets, and transmembrane regions

    • Species-Specific Variations: Target residues that differ between Populus species to understand evolutionary adaptations

    • Post-Translational Modification Sites: Identify potential phosphorylation or redox-sensitive residues

  • Mutagenesis Design Principles:

    • Conservative vs. Non-Conservative Substitutions: Consider the biochemical properties of amino acid replacements

    • Alanine Scanning: Systematically replace residues with alanine to assess functional importance

    • Charge Reversal: Switch positive to negative charges (or vice versa) to test electrostatic interactions

    • Domain Swapping: Replace segments with equivalent regions from other species or homologs

  • Technical Execution:

    • Primer Design: Ensure primers have optimal Tm, minimal secondary structure, and sufficient overlap

    • Mutagenesis Method Selection: Choose between QuikChange, Gibson Assembly, or gateway cloning based on specific needs

    • Mutation Verification: Sequence the entire coding region to confirm targeted changes and absence of unwanted mutations

    • Expression Optimization: Adjust conditions for each mutant, as mutations may affect expression efficiency

  • Functional Assessment Framework:

    • Comparative Analysis: Always test mutants alongside wild-type protein as a reference

    • Multiple Parameters: Assess stability, cofactor binding, electron transfer rates, and protein-protein interactions

    • Structure-Function Correlation: Use homology models to interpret results in a structural context

  • Strategic Mutation Categories:

Mutation CategoryTarget ResiduesExpected OutcomeAnalysis Methods
Heme coordinationHistidine ligandsAltered spectral properties, reduced activityUV-Vis spectroscopy, electron transfer assays
Quinone bindingAromatic/charged residues in binding pocketChanged substrate affinity or specificityEnzyme kinetics, inhibitor binding studies
Transmembrane anchoringHydrophobic residues in transmembrane helicesAltered membrane integrationDetergent solubility tests, proteoliposome incorporation
Protein-protein interactionSurface-exposed residuesModified complex formationCo-IP, SPR, crosslinking studies
Redox regulationCysteine residuesChanged response to redox conditionsThiol modification assays, activity under varying redox potentials
  • Interpretation Framework:

    • Consider both direct effects (on immediate function) and indirect effects (on protein stability)

    • Use multiple mutants to test additive effects or epistatic relationships

    • Apply molecular dynamics simulations to predict and interpret mutational effects

When working with the Populus alba Cytochrome b6 sequence, researchers should compare it with sequences from related species and populations to identify conserved functional elements versus regions that might confer species-specific or population-specific adaptations .

How can recombinant Populus alba Cytochrome b6 studies be integrated with broader plant systems biology research?

Integrating recombinant Populus alba Cytochrome b6 research into plant systems biology requires multidisciplinary approaches:

  • Multi-omics Integration:

    • Transcriptomics: Correlate petB expression patterns with global gene expression networks

    • Proteomics: Map protein-protein interaction networks centered on Cytochrome b6

    • Metabolomics: Link electron transport efficiency to metabolic outputs

    • Phenomics: Connect molecular-level findings to whole-plant physiological responses

  • Modeling Approaches:

    • Kinetic Models: Incorporate biochemical parameters of recombinant Cytochrome b6 into photosynthetic electron transport models

    • Flux Balance Analysis: Predict how alterations in Cytochrome b6 activity affect metabolic fluxes

    • Multi-scale Models: Connect molecular dynamics simulations to cellular and tissue-level models

  • Evolutionary Systems Biology:

    • Compare Cytochrome b6 sequence and function across Populus species and populations

    • Relate genetic diversity patterns to ecological adaptations

    • Study how the unique genetic structure of Sardinian populations (with few genets represented by many ramets) influences systems-level properties

  • Research Integration Framework:

System LevelResearch ApproachIntegration MethodExpected Insight
MolecularRecombinant protein biochemistryParameter determination for modelsFundamental mechanisms and kinetics
OrganellarChloroplast proteomicsNetwork mappingContext of function within photosynthetic apparatus
CellularTransgenic studiesPhenotypic analysisCellular consequences of molecular alterations
Whole plantField experimentsCorrelation analysisConnection to fitness and adaptation
PopulationGenetic surveysStatistical geneticsNatural variation and selection pressures
EcosystemCommon garden experimentsComparative physiologyEcological significance and interactions
  • Technological Integration:

    • Use fluorescently-tagged recombinant proteins for in vivo imaging studies

    • Develop biosensors based on Cytochrome b6 properties to monitor cellular redox state

    • Apply synthetic biology approaches to engineer optimized photosynthetic electron transport

  • Data Integration and Management:

    • Deposit sequence and functional data in public databases

    • Develop standardized protocols for comparing results across labs

    • Create integrated databases linking molecular characteristics to physiological and ecological data

The extensive clonal stands of Populus alba in Sardinia, ranging from 38.6 mile² (100 km²) to over 1,500 mile² (4,000 km²) , provide unique opportunities for systems biology research, as they represent natural experiments where genetic variation is controlled while environmental factors vary across the landscape .

What are the implications of Populus alba's unique genetic structure for comparative studies of Cytochrome b6 function?

The unique genetic structure of Populus alba populations has profound implications for comparative studies of Cytochrome b6 function:

  • Natural Experimental Design Opportunities:

    • Sardinian populations consist of a small number of genets (26), each represented by many ramets

    • This creates natural "replicates" of identical genotypes across different environments

    • Researchers can separate genetic from environmental effects on Cytochrome b6 expression and function

  • Clonal Structure Advantages:

    • Extensive monoclonal stands in Sardinia form linear riparian formations extending several kilometers

    • Some stands cover areas from 38.6 mile² (100 km²) to over 1,500 mile² (4,000 km²)

    • This allows sampling of identical genotypes exposed to varied microenvironments

  • Evolutionary Context:

    • Uniqueness of Sardinian haplotypes at the cpDNA level (vK = 0.15) suggests evolutionary isolation

    • Despite low chloroplast genetic diversity, nuclear genetic diversity remains comparable to mainland populations (HT = 0.60)

    • This dichotomy provides insights into chloroplast-specific selection pressures

  • Hybridization Considerations:

    • Natural hybridization between Populus species creates genetic mosaics

    • Hybrids like P. alba × P. grandidentata express different sprouting capacities and root segment viability

    • These hybrids provide natural experiments in how genetic backgrounds influence Cytochrome b6 function

  • Experimental Design Framework:

Population TypeGenetic StructureResearch AdvantageExperimental Approach
Sardinian populationsFew genets, many ramets, clonal spread Control for genetic background across environmentsEnvironmental gradient sampling within clonal stands
Mainland populationsHigher genetic diversity, sexual reproduction Natural genetic variationAssociation studies linking sequence variants to functional differences
Hybrid zonesMixed genetic background Natural gene shufflingComparison of parental vs. hybrid phenotypes
Relict populationsGenetic bottlenecks, unique haplotypes Evolutionary experimentsComparison with more diverse populations
  • Methodological Implications:

    • Sampling strategies should account for clonal structure to avoid pseudoreplication

    • Molecular authentication is essential to confirm genotypic identity

    • Experimental designs can leverage clonal structure to increase statistical power

The prevalence of clonal reproduction in Sardinian white poplar, with stands extending for kilometers and covering large areas , provides unique opportunities for studying how identical Cytochrome b6 genotypes function across environmental gradients, offering insights that would be difficult to obtain from sexually reproducing populations with greater genetic heterogeneity.

How can researchers design experiments to investigate the role of Populus alba Cytochrome b6 in climate adaptation?

Designing experiments to investigate Populus alba Cytochrome b6's role in climate adaptation requires strategic approaches that leverage both recombinant protein studies and population-level analyses:

  • Gradient Sampling Strategies:

    • Altitudinal Transects: Sample populations along elevation gradients to capture temperature variation

    • Latitudinal Sampling: Compare populations from different latitudes to assess adaptation to light and temperature regimes

    • Moisture Gradients: Sample across rainfall gradients to identify drought adaptation mechanisms

    • Advantage of Sardinian Populations: Sample within extensive clonal stands that span environmental gradients

  • Common Garden Experiments:

    • Establish plants from different source populations in a single environment

    • Monitor photosynthetic performance under controlled conditions

    • Challenge with simulated climate extremes (heat, drought, high light)

    • Compare physiological responses and relate to Cytochrome b6 sequence/expression

  • Reciprocal Transplant Studies:

    • Transplant material between contrasting environments

    • Measure photosynthetic electron transport parameters in situ

    • Correlate performance with Cytochrome b6 genetic variants

    • Compare mainland versus Sardinian populations with their unique haplotypes

  • Molecular Mechanistic Studies:

    • Express recombinant Cytochrome b6 variants from populations adapted to different climates

    • Compare biochemical properties under varying temperature, pH, and redox conditions

    • Assess thermal stability and functional temperature optima of different variants

    • Investigate how sequence variations affect electron transport efficiency

  • Experimental Design Matrix:

Climate FactorField ApproachLaboratory ApproachIntegration Method
TemperatureThermal imaging of photosynthetic performance in situTemperature-dependent activity assays with recombinant proteinCorrelation of thermal optima with habitat temperatures
DroughtWater potential measurements and electron transport efficiency in fieldMembrane composition effects on reconstituted Cytochrome b6Linking membrane adaptation to protein function
High lightChlorophyll fluorescence under natural light gradientsPhotoinhibition resistance of different protein variantsConnecting molecular mechanisms to field performance
CO₂ variationFree-Air CO₂ Enrichment (FACE) experimentsCoupling efficiency with varying electron acceptor concentrationsScaling from molecular to ecosystem responses
  • Multi-level Analysis Framework:

    • Sequence petB gene from populations across climate gradients

    • Identify amino acid substitutions correlated with climate variables

    • Express recombinant variants and test functional differences

    • Verify adaptive significance in whole-plant physiology

    • Model impacts on population persistence under climate change scenarios

The unique genetic structure of Populus alba populations, particularly the extensive monoclonal stands in Sardinia covering areas up to 1,500 mile² (4,000 km²) , provides exceptional opportunities for climate adaptation research by allowing researchers to separate genetic from environmental effects across natural climate gradients .

What reference data should researchers maintain for standardizing Populus alba Cytochrome b6 experiments?

To ensure experimental reproducibility and facilitate cross-laboratory comparisons, researchers should maintain the following reference data for Populus alba Cytochrome b6:

  • Protein Sequence and Structure Information:

    • Full amino acid sequence (215 aa) with UniProt ID (Q14FC7)

    • Predicted secondary structure elements (transmembrane helices, loops)

    • Homology models based on crystal structures of homologous proteins

    • Identification of functional domains and critical residues

  • Spectroscopic Reference Data:

    • Baseline UV-visible spectra of properly folded protein (oxidized and reduced forms)

    • Circular dichroism spectra indicating correct secondary structure

    • Fluorescence emission spectra (intrinsic and with specific probes)

    • Standard curves for protein quantification methods

  • Functional Parameters:

    • Standard activity measurements under defined conditions

    • Km and kcat values for physiological substrates

    • pH and temperature activity profiles

    • Stability data (thermal denaturation curves, time-dependent activity loss)

  • Genetic Reference Information:

    • Complete petB gene sequence from reference Populus alba individuals

    • Known haplotypes and their frequency in different populations

    • Primer sequences for amplification and sequencing

    • Genetic diversity parameters (HT = 0.60, vK = 0.15 for Sardinian populations)

  • Standardized Data Collection Table:

ParameterStandard ConditionExpected ValueAcceptable RangeValidation Method
Protein puritySDS-PAGE>90% 85-100%Densitometry analysis
Soret band positionpH 7.5, oxidized~410 nm±2 nmUV-visible spectroscopy
α/β band positionspH 7.5, reduced~552/563 nm±2 nmUV-visible spectroscopy
Electron transfer rate25°C, pH 7.5[Standard value]±15%Defined assay protocol
Thermal stability (Tm)pH 7.5, buffer specified[Standard value]±3°CDifferential scanning fluorimetry
Reductant binding (Kd)25°C, pH 7.5[Standard value]±25%Equilibrium binding assay
  • Population Reference Data:

    • Geographic distribution of sampled populations

    • Clonal structure information (particularly for Sardinian populations)

    • Environmental parameters of collection sites

    • Phenotypic characteristics of source populations

Maintaining comprehensive reference data is particularly important for Populus alba Cytochrome b6 research given the unique genetic structure of this species, with extensive clonal populations in Sardinia forming stands that cover large areas (up to 1,500 mile² or 4,000 km²) and consist of a small number of genets (26) each represented by multiple ramets .

What ethical considerations should guide collection of Populus alba samples for petB studies?

Researchers collecting Populus alba samples for petB studies should adhere to these ethical considerations:

  • Conservation Status Awareness:

    • Assess local conservation status of Populus alba populations before sampling

    • Recognize that Mediterranean basin habitats are highly fragmented

    • Consider the unique value of relict populations, particularly on islands like Sardinia

  • Sustainable Sampling Protocols:

    • Minimize damage to source trees (collect small branches rather than coring)

    • Implement non-destructive sampling methods where possible

    • Limit sample size to scientific necessity

    • Avoid depleting smaller populations

  • Biodiversity and Genetic Resource Considerations:

    • Recognize the scientific value of unique haplotypes in Sardinian populations

    • Consider that some populations may consist of very few genets despite many ramets

    • Document and preserve genetic diversity through careful sampling across populations

  • Permit and Legal Requirements:

    • Obtain necessary permits from relevant authorities

    • Comply with national and international regulations on biological sample collection

    • Adhere to the Nagoya Protocol on Access and Benefit Sharing when applicable

    • Obtain landowner permission for sampling on private property

  • Indigenous and Local Knowledge:

    • Respect traditional knowledge related to poplar tree management

    • Engage with local communities regarding research goals and potential benefits

    • Consider benefit-sharing arrangements when traditional knowledge is utilized

  • Documentation and Data Sharing:

    • Maintain detailed records of sampling locations, dates, and methods

    • Deposit voucher specimens in recognized herbaria

    • Share genetic sequence data through public databases

    • Publish methodological details to enable reproducibility

  • Best Practices Framework:

Ethical DimensionRecommended ActionsDocumentation Required
Conservation impactSurvey population size and structure before samplingPopulation assessment report
Sampling intensityLimit to <5% of individual tree biomassSampling protocol documentation
Genetic diversity preservationSample across multiple populations and genotypesGenotype verification data
Legal complianceObtain permits before fieldworkCopies of all permits and approvals
Community engagementConsult with local stakeholdersMeeting records and agreements
Open scienceDeposit data in public repositoriesAccession numbers and citations

The unique clonal structure of Sardinian Populus alba populations, where extensive monoclonal stands can cover areas ranging from 38.6 mile² (100 km²) to over 1,500 mile² (4,000 km²) , requires special consideration in sampling design to ensure genetic representation while minimizing impact on these potentially relict populations .

What are the best practices for data sharing and reproducibility in Populus alba Cytochrome b6 research?

Adhering to best practices for data sharing and reproducibility is crucial for advancing Populus alba Cytochrome b6 research:

  • Genetic Sequence Data Management:

    • Deposit full petB gene sequences in GenBank or similar repositories

    • Include detailed metadata about source populations

    • Document the unique haplotypes found in different populations, especially the distinct Sardinian variants

    • Link sequence accessions to published research papers

  • Protein Characterization Data Sharing:

    • Report complete spectroscopic and functional data sets

    • Include raw data when possible, not just processed results

    • Document all experimental conditions precisely

    • Share reference spectra and standard curves

  • Detailed Methodology Documentation:

    • Provide complete protocols with no omitted steps

    • Specify reagent sources, catalog numbers, and lot numbers when relevant

    • Document equipment models, calibration status, and settings

    • Report all buffer compositions and preparation methods

  • Population and Ecological Data Integration:

    • Geo-reference all sampling locations

    • Document population characteristics, including clonal structure information

    • Report relevant environmental parameters

    • Consider depositing data in ecological databases

  • Open Science Framework Implementation:

Research ComponentData RepositoryMetadata RequirementsVersion Control
Gene sequencesGenBank/ENACollection location, date, population structureTrack sequence updates
Protein characterizationProteomics repositories (PRIDE)Experimental conditions, purification methodDocument protocol versions
Structural dataProtein Data Bank (PDB) for structuresRefinement parameters, quality metricsTrack model improvements
Ecological dataGBIF or similarSampling design, environmental parametersDocument collection methods
Analysis codeGitHub or similarDependencies, input formatUse semantic versioning
  • Reproducibility Enhancement Measures:

    • Maintain standardized reference samples for inter-laboratory comparison

    • Develop and share validated protocols for key assays

    • Use consistent data analysis methods and reporting formats

    • Consider pre-registration of study designs for major research projects

  • Collaborative Research Practices:

    • Establish material transfer agreements for sharing biological samples

    • Define data ownership and authorship criteria before project initiation

    • Implement regular quality control checks between collaborating laboratories

    • Create shared databases for multi-investigator projects

For Populus alba Cytochrome b6 research, particularly when studying proteins from different populations such as the genetically distinct Sardinian populations , maintaining clear documentation of genetic sources is essential for reproducibility and proper interpretation of functional differences.

What are the current knowledge gaps in understanding Populus alba Cytochrome b6 structure and function?

Despite significant advances, several knowledge gaps remain in understanding Populus alba Cytochrome b6:

  • Structural Knowledge Limitations:

    • No high-resolution 3D structure exists specifically for Populus alba Cytochrome b6

    • The precise orientation of transmembrane helices in the lipid bilayer remains uncertain

    • Conformational changes during electron transfer are poorly characterized

    • Interactions between the 215-amino acid protein and other components of the b6f complex need further elucidation

  • Functional Uncertainties:

    • Efficiency variations between population-specific variants are largely unexplored

    • Regulatory mechanisms affecting Cytochrome b6 function in response to environmental stresses remain unclear

    • Role in alternative electron transfer pathways under stress conditions needs investigation

    • Post-translational modifications and their functional consequences are under-studied

  • Population-Level Knowledge Gaps:

    • Functional consequences of the unique haplotypes found in Sardinian populations

    • Relationship between clonal structure and Cytochrome b6 sequence conservation or variation

    • Selective pressures that maintain certain variants in specific environments

    • Implications of limited sexual reproduction in Sardinian populations for petB evolution

  • Methodological Challenges:

    • Difficulties in expressing and purifying membrane proteins with native-like properties

    • Limitations in measuring electron transfer in complex systems

    • Challenges in correlating in vitro measurements with in vivo function

    • Technical barriers to studying protein dynamics at relevant timescales

  • Research Gap Analysis Framework:

Research AreaCurrent KnowledgeKnowledge GapResearch Approach Needed
Protein structurePredicted secondary structure based on homologyHigh-resolution 3D structureCryo-EM or X-ray crystallography of isolated protein
Population variationGenetic diversity patterns Functional consequences of variantsComparative biochemistry of variants from different populations
Environmental adaptationGeneral photosynthetic responsesCytochrome b6-specific adaptationsTargeted studies linking sequence variations to environmental parameters
RegulationBasic expression patternsPost-translational regulationPhosphoproteomics and redox proteomics approaches
System integrationComponent interactionsDynamic responses to environmental changeTime-resolved spectroscopy and in vivo imaging
  • Evolutionary Knowledge Gaps:

    • Selective forces acting on petB in different Populus species and populations

    • Implications of hybridization between P. alba and other Populus species for Cytochrome b6 function

    • Evolutionary history of the unique Sardinian haplotypes and their relationship to mainland variants

Addressing these knowledge gaps would significantly advance our understanding of how Populus alba Cytochrome b6 functions at the molecular level and how this relates to adaptation and evolution at the population and species levels.

What emerging technologies are likely to advance Populus alba Cytochrome b6 research in the next decade?

Several emerging technologies are poised to revolutionize research on Populus alba Cytochrome b6 in the coming decade:

  • Advanced Structural Biology Approaches:

    • Cryo-Electron Microscopy: Will enable high-resolution structures of Cytochrome b6 within native complexes

    • Microcrystal Electron Diffraction (MicroED): Will allow structure determination from nano-sized crystals

    • Single-Particle Analysis: Will reveal conformational heterogeneity during the catalytic cycle

    • In-cell NMR: Will provide insights into structural dynamics in native-like environments

  • Next-Generation Genomic and Transcriptomic Tools:

    • Long-read Sequencing: Will improve characterization of complete petB gene loci and surrounding regions

    • Single-Cell Transcriptomics: Will reveal cell-type specific expression patterns in different tissues

    • Spatial Transcriptomics: Will map petB expression patterns across tissue sections

    • CRISPR-based Gene Editing: Will enable precise modification of petB in planta for functional studies

  • Advanced Imaging Technologies:

    • Super-resolution Microscopy: Will visualize Cytochrome b6 distribution and dynamics at nanometer resolution

    • Label-free Imaging: Will track native proteins without modification-induced artifacts

    • Correlative Light and Electron Microscopy (CLEM): Will connect functional states to structural arrangements

    • Functional Imaging Probes: Will report on electron flow and redox states in living cells

  • Synthetic Biology and Protein Engineering:

    • De Novo Protein Design: Will create optimized Cytochrome b6 variants with enhanced properties

    • Expanded Genetic Code: Will incorporate non-canonical amino acids for specialized functions and probes

    • Cell-free Expression Systems: Will enable rapid production and testing of protein variants

    • Artificial Chloroplasts: Will provide minimal systems for studying Cytochrome b6 function

  • Computational and Modeling Advances:

    • Molecular Dynamics Simulations: Will predict protein dynamics at atomic resolution across biologically relevant timescales

    • Machine Learning Approaches: Will identify subtle structure-function relationships from large datasets

    • Quantum Mechanical Calculations: Will elucidate electron transfer mechanisms with unprecedented detail

    • Multi-scale Modeling: Will connect molecular events to cellular and organism-level phenotypes

  • Technology Implementation Timeline:

TimeframeEmerging TechnologyExpected Impact on Cytochrome b6 Research
0-3 yearsCryo-EM of membrane protein complexesHigh-resolution structures of Cytochrome b6 in native complexes
2-5 yearsCRISPR editing in PopulusDirect testing of sequence variants in planta
3-7 yearsSingle-molecule electron transfer measurementsReal-time visualization of electron flow through individual proteins
5-10 yearsSynthetic chloroplasts with engineered componentsTesting of optimized Cytochrome b6 variants in minimal systems
7-10+ yearsQuantum biology applicationsUnderstanding quantum coherence effects in electron transfer

These emerging technologies will greatly enhance our ability to study the unique aspects of Populus alba Cytochrome b6, particularly in relating the specific sequence characteristics of the 215-amino acid protein to its function and adaptation across different populations, including the genetically distinct Sardinian populations with their unique haplotypes .

How might research on Populus alba Cytochrome b6 contribute to broader goals in plant biotechnology and climate adaptation?

Research on Populus alba Cytochrome b6 has significant potential to contribute to broader goals in plant biotechnology and climate adaptation:

  • Photosynthetic Efficiency Enhancement:

    • Knowledge Contribution: Understanding how natural variations in Cytochrome b6 sequence affect electron transport efficiency

    • Application: Engineering optimized variants to reduce energy losses during photosynthesis

    • Potential Impact: Crops with enhanced productivity under limiting light conditions

    • Research Connection: Comparative analysis of Cytochrome b6 variants from different Populus alba populations adapted to varying light environments

  • Stress Tolerance Improvement:

    • Knowledge Contribution: Elucidating how Cytochrome b6 functions under temperature, drought, and high light stress

    • Application: Developing crops with robust photosynthetic apparatus under climate extremes

    • Potential Impact: Stabilized yields under fluctuating climate conditions

    • Research Connection: Studying the unique adaptations of Sardinian populations that have persisted in Mediterranean conditions

  • Climate Adaptation Strategies:

    • Knowledge Contribution: Understanding genetic adaptations in natural Populus alba populations across climate gradients

    • Application: Identifying genetic resources for adaptation to changing climates

    • Potential Impact: Improved forest resilience to climate change

    • Research Connection: Analysis of population-specific variants from contrasting environments, including the unique Sardinian haplotypes

  • Bioenergy Applications:

    • Knowledge Contribution: Understanding factors affecting photosynthetic efficiency in woody species

    • Application: Optimizing biomass production for bioenergy applications

    • Potential Impact: Enhanced carbon capture and sustainable energy production

    • Research Connection: Leveraging knowledge of clonal reproduction and growth characteristics

  • Conservation Genomics:

    • Knowledge Contribution: Understanding genetic diversity patterns in fragmented populations

    • Application: Developing conservation strategies for preserving adaptive genetic variation

    • Potential Impact: More effective management of forest genetic resources

    • Research Connection: Insights from the genetic structure and clonal reproduction of Sardinian populations

  • Cross-cutting Implementation Framework:

Application AreaResearch FocusTechnology Transfer ApproachExpected Timeline
Photosynthesis engineeringStructure-function of electron transport variantsTransgenic introduction of optimized variants5-10 years
Stress adaptationFunctional responses to environmental extremesMarker-assisted selection for adaptive variants3-7 years
Forest managementPopulation genetic structure and adaptationConservation guidelines based on genetic findings1-5 years
Bioenergy optimizationGrowth characteristics linked to photosynthetic efficiencySelection of high-performing clones3-8 years
Climate modelingPhysiological response parametersImproved vegetation models for climate predictions2-6 years
  • Transformative Research Directions:

    • Development of synthetic Cytochrome b6 variants with novel properties

    • Creation of chimeric proteins combining features from different species and populations

    • Engineering of alternative electron transport pathways for specialized applications

    • Development of biosensors based on Cytochrome b6 properties for environmental monitoring

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.