Recombinant Populus alba NAD (P)H-quinone oxidoreductase subunit 1, chloroplastic (ndhA)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Populus alba NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic (ndhA), is a plastid-encoded protein critical for the function of the chloroplast NAD(P)H dehydrogenase (NDH) complex. This enzyme plays a central role in cyclic electron transport around photosystem I (PSI) and chlororespiration, processes essential for maintaining photosynthetic efficiency and stress resilience in plants . The recombinant form of ndhA is engineered for biochemical and structural studies, enabling detailed investigations into its catalytic and regulatory roles.

Role in the Chloroplast NDH Complex

ndhA is a core subunit of the chloroplast NDH complex, which forms an L-shaped structure homologous to cyanobacterial NDH-1 . This complex:

  • Facilitates PSI cyclic electron transport to generate ATP .

  • Participates in chlororespiration under stress conditions .

  • Interacts with PSI to form a supercomplex during chloroplast development .

Enzymatic Properties

While direct kinetic data for recombinant ndhA is limited, studies on related plant NDH complexes reveal:

  • Subunit Interactions: ndhA associates with other subunits (e.g., ndhH, ndhK) to form a membrane subcritical for proton translocation .

  • Functional Redundancy: ndhA homologs in Arabidopsis and maize are indispensable for NDH assembly and activity .

Research Applications

Recombinant ndhA is utilized in:

  1. Structural Studies: Elucidating the architecture of the NDH-PSI supercomplex .

  2. Functional Assays: Probing electron transport kinetics and inhibitor responses .

  3. Stress Physiology: Investigating NDH’s role in mitigating oxidative damage .

  • Structural Fragility: The NDH complex is prone to disintegration during isolation, necessitating mild detergents for stabilization .

  • Heterologous Expression: Optimizing E. coli systems for improved yield of functional ndhA .

  • Editing Mechanisms: ndhA transcripts undergo RNA editing (e.g., C-to-U modifications) to restore conserved amino acids, a feature requiring further study .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request as much as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-365
Protein Length
full length protein
Species
Populus alba (White poplar)
Target Names
ndhA
Target Protein Sequence
MIIDTTTVQAINSFSRLKSLNEVYGIIWMLVPILTLVLGITIGILVIVWLEREISAGIQQ RIGPEYAGPFGVLQALADGTKLLFKENLFPSRGDTRLFSIGPSIAVISTLLSYSVIPFGY HFVLADLNIGVFLWIAISSIAPIGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTLCVL SISLLSNSSSTVDIVEAQSKYGFGGWNLWRQPIGFIIFFISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKFGLFYVASYLNLLVSSLFVAVLYLGGWNISIPYISVPEFFDFEINKVG RVFGTTMGILITLVKTYLFLFIPITTRWTLPRLRMDQLLNLGWKFLLPISLGNLLLTTSS QLFSL
Uniprot No.

Target Background

Function
NDH facilitates the transfer of electrons from NAD(P)H:plastoquinone, through FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, plastoquinone is believed to be the immediate electron acceptor for the enzyme. It couples the redox reaction with proton translocation, thereby conserving the redox energy within a proton gradient.
Protein Families
Complex I subunit 1 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of NAD(P)H-quinone oxidoreductase subunit 1 (ndhA) in plant chloroplasts?

The ndhA protein functions as a critical subunit of the chloroplast NAD(P)H dehydrogenase (NDH) complex, which participates in both photosystem I (PSI) cyclic electron transport and chlororespiration. This complex is structurally and functionally related to the bacterial and mitochondrial NADH dehydrogenase (complex I), suggesting evolutionary conservation across different organisms . The NDH complex containing ndhA helps facilitate electron transfer from NAD(P)H to plastoquinone in the thylakoid membrane, contributing to ATP synthesis without simultaneous NADP+ reduction, particularly under stress conditions when linear electron flow may be limited.

Where is the ndhA gene located in Populus alba?

The ndhA gene is located in the chloroplast genome of Populus alba, specifically within the plastid genome. Like other ndh genes (ndhA-ndhK), it is part of the conserved gene set found in the plastid genomes of most land plants . In the related hybrid poplar species, Populus alba × P. tremula var. glandulosa (Poplar 84K), complete chloroplast and mitochondrial genomes have been assembled, with distinct subgenomes identified representing contributions from the parent species .

What are the recommended conditions for recombinant ndhA expression in E. coli?

Based on protocols for similar NDH subunits from Populus alba, recombinant ndhA expression typically utilizes E. coli expression systems with appropriate vector constructs containing the full-length protein coding sequence . For optimal expression, use a bacterial strain designed for recombinant protein production (BL21(DE3), Rosetta, etc.) with induction parameters of 0.5-1.0 mM IPTG at mid-log phase (OD600 ~0.6). Expression should be conducted at 16-18°C for 16-20 hours to minimize inclusion body formation, as membrane proteins like ndhA often face folding challenges at higher temperatures. Verification of expression can be performed using SDS-PAGE and western blotting with antibodies specific to either ndhA or an attached purification tag.

What purification strategies are most effective for recombinant ndhA protein?

For purification of recombinant ndhA protein, a multi-step approach is recommended:

  • Cell lysis: Use gentle lysis methods (mild detergents or enzymatic lysis) to preserve protein structure.

  • Initial purification: Employ affinity chromatography using histidine, GST, or other fusion tags.

  • Secondary purification: Apply ion exchange chromatography or size exclusion chromatography.

  • Detergent considerations: Throughout purification, maintain appropriate detergent concentrations (0.1-0.5% n-dodecyl β-D-maltoside or similar) to preserve membrane protein solubility .

Protein purity should be verified using SDS-PAGE, aiming for >85% purity similar to other NDH complex proteins . For specific research applications requiring higher purity, additional chromatography steps may be necessary.

How should recombinant ndhA protein be stored to maintain stability?

Optimal storage conditions for recombinant ndhA protein should follow protocols established for similar NDH subunits. The protein should be concentrated to 0.1-1.0 mg/mL in a physiologically relevant buffer (typically Tris or phosphate buffer at pH 7.4-8.0 with 100-150 mM NaCl). For long-term storage, add glycerol to a final concentration of 5-50% (with 50% being optimal for maximum stability) and store in small aliquots at -20°C or preferably -80°C . Under these conditions, the expected shelf life is approximately 6 months for liquid formulations and 12 months for lyophilized preparations. Repeated freeze-thaw cycles should be avoided; working aliquots can be stored at 4°C for up to one week .

How can researchers assess the functional integrity of purified recombinant ndhA?

To evaluate the functional integrity of purified recombinant ndhA, researchers should employ multiple complementary approaches:

  • Enzymatic activity assays: Measure NAD(P)H oxidation rates spectrophotometrically by monitoring the decrease in absorbance at 340 nm in the presence of appropriate electron acceptors like ferricyanide or dichlorophenolindophenol (DCPIP).

  • Reconstitution experiments: Attempt to reconstitute partial NDH complexes by combining purified ndhA with other recombinant NDH subunits, then assessing complex formation via native PAGE or gel filtration chromatography.

  • Protein-protein interaction studies: Use pull-down assays or surface plasmon resonance (SPR) to verify ndhA's ability to interact with other NDH complex components, particularly those in the A subcomplex .

  • Circular dichroism (CD) spectroscopy: Evaluate secondary structure composition to ensure proper folding, particularly important for membrane proteins that may denature during purification.

Researchers should expect functional recombinant ndhA to demonstrate specific binding to other NDH subunits and contribute to measurable electron transport activities when properly incorporated into partial or complete NDH complexes.

What differences exist between ndhA from Populus alba and other plant species?

SpeciesSequence Identity to P. alba ndhANotable Variations
P. tremula~98-99%Minor amino acid substitutions in non-critical domains
P. trichocarpa~95-97%Variations in N-terminal region
Arabidopsis thaliana~85-90%Differences in transmembrane domain organization
Zea mays~80-85%Variations in loop regions between conserved domains

These differences may influence protein-protein interactions within species-specific NDH complexes, potentially contributing to variations in cyclic electron flow efficiency under different environmental conditions. Researchers studying Populus alba ndhA should consider these interspecific differences when extrapolating findings from model plant systems.

How does post-translational modification affect ndhA function?

Post-translational modifications (PTMs) significantly impact ndhA function and stability within the NDH complex. While specific PTM data for Populus alba ndhA is limited, research on related species suggests several important modifications:

  • Phosphorylation: Regulatory phosphorylation sites, particularly on serine and threonine residues in stromal-facing domains, likely modulate ndhA activity in response to changing light conditions and redox states.

  • Acetylation: N-terminal acetylation may influence protein stability and interaction with other NDH complex components.

  • Disulfide bond formation: Conserved cysteine residues can form disulfide bonds that maintain structural integrity, particularly important under oxidative stress conditions.

To investigate PTMs experimentally, researchers should employ mass spectrometry-based approaches, comparing ndhA modifications under different environmental conditions (high light, drought, temperature stress) to establish correlations between specific modifications and functional changes in NDH complex activity.

What approaches are recommended for studying ndhA gene expression in Populus alba?

For comprehensive analysis of ndhA gene expression in Populus alba, researchers should implement multi-faceted approaches:

  • Quantitative RT-PCR: Design primers specific to the Populus alba ndhA sequence, avoiding regions of high homology with other ndh genes. Reference genes should be carefully selected based on stability across experimental conditions.

  • RNA-Seq analysis: Perform transcriptome-wide analysis to evaluate ndhA expression relative to other chloroplast genes and nuclear genes encoding NDH-interacting proteins.

  • Promoter analysis: Investigate the regulatory elements controlling ndhA expression through chloroplast-specific promoter analysis techniques.

  • Tissue-specific expression: Analyze expression patterns across different tissues and developmental stages, particularly focusing on tissues with varying photosynthetic capacities.

When interpreting expression data, researchers should consider the findings from the Poplar 84K genome analysis, which revealed transcriptional bias between subgenomes in hybrid poplar species . This may provide valuable insights into evolutionary adaptations in ndhA expression patterns.

How can CRISPR/Cas9 be adapted for chloroplast genome editing to study ndhA function?

Adapting CRISPR/Cas9 for chloroplast genome editing to study ndhA function presents unique challenges due to the distinct characteristics of chloroplast genomes. Researchers should consider the following methodology:

  • Chloroplast-specific CRISPR system: Utilize a modified Cas9 with a chloroplast transit peptide and codon optimization for chloroplast expression.

  • Guide RNA design: Design sgRNAs specific to ndhA regions while avoiding homology with nuclear genome sequences to prevent off-target effects.

  • Transformation strategy: Employ biolistic transformation methods rather than Agrobacterium-mediated approaches for chloroplast targeting, leveraging the high transformability observed in Populus species .

  • Selection markers: Use spectinomycin or similar antibiotics with targets in the chloroplast for selection of transplastomic plants.

  • Homoplasmy verification: Confirm complete replacement of wild-type chloroplast genomes through PCR and sequencing across multiple generations.

The resulting ndhA mutants should be phenotypically characterized under various light conditions and stresses to evaluate the specific contributions of this subunit to NDH complex function in Populus alba.

How does the ndhA subunit contribute to stress resistance in Populus alba?

The ndhA subunit plays a crucial role in stress resistance in Populus alba through its participation in the chloroplast NDH complex. This complex contributes to stress resilience through several mechanisms:

  • Cyclic electron flow enhancement: Under stress conditions, the NDH complex containing ndhA facilitates increased cyclic electron flow around PSI, generating additional ATP without producing excess reducing power that could lead to reactive oxygen species (ROS) formation .

  • Photoprotection: By dissipating excess excitation energy, the NDH complex helps prevent photoinhibition during high light stress, drought, or temperature extremes.

  • Redox balance maintenance: The complex helps maintain optimal redox status in the chloroplast electron transport chain during fluctuating environmental conditions.

The evolution of chloroplast NDH in land plants, including the specialized structure seen in Populus species, appears specifically adapted to alleviate oxidative stress in chloroplasts . Experimental data from related species suggests that plants with compromised ndhA function show decreased photosynthetic efficiency and increased sensitivity to photoinhibition under stress conditions, highlighting the physiological importance of this subunit.

What methods are most effective for investigating ndhA protein interactions within the NDH complex?

To effectively investigate ndhA protein interactions within the NDH complex, researchers should employ multiple complementary techniques:

  • Co-immunoprecipitation (Co-IP): Using antibodies against ndhA or tagged versions of the protein to pull down interacting partners, followed by mass spectrometry identification. This approach has successfully identified novel subunits of the NDH complex in other species .

  • Yeast two-hybrid (Y2H) screening: Though challenging for membrane proteins, modified split-ubiquitin Y2H systems can be employed to detect ndhA interactions with other NDH subunits.

  • Bimolecular fluorescence complementation (BiFC): This approach allows visualization of protein interactions in planta by expressing ndhA and potential interacting partners as fusion proteins with complementary fluorescent protein fragments.

  • Cryo-electron microscopy: For structural characterization of the entire NDH complex, including precise positioning of ndhA within the assembled structure.

  • Cross-linking mass spectrometry: Chemical cross-linking followed by mass spectrometry analysis can identify proximity relationships between ndhA and other subunits at the peptide level.

When interpreting interaction data, researchers should consider that the chloroplast NDH complex interacts with multiple copies of PSI to form the unique NDH-PSI supercomplex, with specific light-harvesting complex I (LHCI) proteins mediating this interaction .

What is the relationship between ndhA function and photosynthetic efficiency in Populus species?

The relationship between ndhA function and photosynthetic efficiency in Populus species is complex and environmentally dependent. Based on research in related plant systems:

  • Standard growth conditions: Under optimal growth conditions, the contribution of ndhA to photosynthetic efficiency appears modest, with mutants showing minimal phenotypic differences from wild-type plants.

  • Fluctuating light conditions: When plants experience rapidly changing light intensities, ndhA's contribution to NDH-mediated cyclic electron flow becomes critical for maintaining optimal photosynthetic efficiency by balancing ATP/NADPH ratios.

  • Abiotic stress response: Under drought, high temperature, or high light stress, the NDH complex containing ndhA becomes essential for maintaining photosynthetic efficiency through enhanced cyclic electron flow and photoprotection.

  • CO₂ limitation: When stomatal conductance is restricted during water deficit, increased NDH activity helps maintain photosynthetic efficiency despite limited CO₂ availability.

This functional relationship is particularly relevant for Populus species, which as pioneer trees often colonize challenging environments where stress resistance is essential for survival. The extensive cultivation of certain Populus hybrids, such as Poplar 84K in northern China, suggests adaptation to diverse environmental conditions where efficient photosynthesis under stress may provide ecological advantages .

How do ndhA sequence variations correlate with ecological adaptations in different Populus populations?

Sequence variations in the ndhA gene across different Populus populations often correlate with specific ecological adaptations. Studies of Populus alba populations in diverse environments, such as those in Sardinia forming large monoclonal stands , reveal subtle but functionally significant polymorphisms in chloroplast genes including ndhA. These variations potentially contribute to:

  • Temperature adaptation: Specific amino acid substitutions in ndhA transmembrane domains correlate with adaptation to different temperature regimes, potentially altering protein stability or electron transport kinetics under thermal stress.

  • Drought tolerance: Variations in regulatory regions and coding sequences of ndhA have been linked to enhanced cyclic electron flow efficiency during water limitation in some Populus ecotypes.

  • Light adaptation: Populations from high-light environments often show ndhA sequence adaptations that may enhance photoprotection through more efficient NDH complex assembly or activity.

Analysis of epigenetic diversity in clonal Populus alba populations further suggests that methylation status may influence ndhA expression patterns in response to environmental conditions , representing an additional layer of adaptive regulation beyond sequence variation.

What structural differences exist between ndhA and ndhH subunits in the chloroplast NDH complex?

The ndhA and ndhH subunits, both critical components of the chloroplast NDH complex, exhibit several structural differences that reflect their distinct functional roles:

FeaturendhAndhH
Molecular WeightApproximately 40 kDaApproximately 49 kDa
Membrane AssociationMultiple transmembrane domainsFewer transmembrane regions
Subcomplex LocationA subcomplexA subcomplex
Sequence ConservationModerately conserved across speciesHighly conserved across species
Known DomainsElectron transport domainsNAD(P)H binding domains

What strategies can overcome the challenges of producing functional recombinant chloroplast membrane proteins?

Producing functional recombinant chloroplast membrane proteins like ndhA presents several challenges. Researchers can employ these effective strategies:

  • Expression system optimization:

    • Use specialized E. coli strains (C41(DE3), C43(DE3)) specifically designed for membrane protein expression

    • Consider cell-free expression systems that bypass inclusion body formation

    • Explore eukaryotic expression systems (yeast, insect cells) for complex membrane proteins

  • Protein solubilization approaches:

    • Test multiple detergents systematically (DDM, LDAO, Fos-choline)

    • Implement detergent screening platforms to identify optimal solubilization conditions

    • Consider novel amphipathic polymers (amphipols) or nanodiscs for maintaining native structure

  • Fusion partner strategies:

    • Employ solubility-enhancing fusion tags (MBP, SUMO, Mistic)

    • Position tags strategically to avoid disrupting transmembrane domains

    • Include protease cleavage sites for tag removal when necessary

  • Refolding protocols:

    • Develop gradual dialysis methods for proteins expressed in inclusion bodies

    • Use artificial chaperone-assisted refolding with cyclodextrin

    • Implement on-column refolding during purification

These strategies should be optimized specifically for ndhA, with careful monitoring of protein folding and function throughout the production process to ensure the recombinant protein accurately represents the native state.

How can researchers distinguish between specific and non-specific binding in ndhA interaction studies?

Distinguishing between specific and non-specific binding in ndhA interaction studies requires rigorous experimental controls and validation approaches:

  • Competition assays: Perform binding experiments in the presence of increasing concentrations of unlabeled potential interactors. Specific interactions will show dose-dependent inhibition patterns.

  • Mutational analysis: Introduce specific mutations in predicted interaction domains of ndhA and observe their effects on binding. True interactions will be disrupted by mutations in critical interface residues.

  • Reciprocal co-IP experiments: Confirm interactions by performing pull-downs with antibodies against both ndhA and its putative partner proteins. Genuine interactions should be detectable in both directions.

  • Stringency optimization: Systematically increase salt concentrations or detergent levels in binding buffers. Non-specific interactions typically dissociate at lower stringency than biologically relevant interactions.

  • Negative controls: Include unrelated chloroplast proteins with similar physical properties as negative controls in all interaction experiments.

  • Quantitative binding measurements: Use techniques like isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to determine binding affinities. Specific interactions typically show nanomolar to low micromolar affinities with defined stoichiometry.

Implementation of these approaches will help ensure that reported ndhA interactions represent physiologically relevant associations within the NDH complex rather than experimental artifacts.

What emerging technologies could advance understanding of ndhA function in plant stress responses?

Several emerging technologies hold significant promise for advancing our understanding of ndhA function in plant stress responses:

  • Single-molecule tracking: Implementing fluorescence-based single-molecule tracking of tagged ndhA proteins in vivo could reveal dynamic changes in NDH complex assembly and localization during stress responses with unprecedented temporal and spatial resolution.

  • Cryo-electron tomography: This technology enables visualization of macromolecular complexes in their native cellular environment, potentially revealing how NDH complexes containing ndhA reorganize within the thylakoid membrane under stress conditions.

  • Genome-wide association studies (GWAS): Application of GWAS across diverse Populus populations could identify natural variations in ndhA and interacting genes that correlate with enhanced stress tolerance, particularly relevant given the genomic resources available for poplar species .

  • Optogenetic control systems: Development of light-activated control of ndhA expression or NDH complex activity could enable precise temporal manipulation of cyclic electron flow during specific phases of stress responses.

  • Multi-omics integration platforms: Combining transcriptomics, proteomics, and metabolomics data through machine learning approaches could reveal previously unrecognized relationships between ndhA function and broader metabolic adaptations during stress.

These technologies, particularly when applied to well-characterized systems like Populus alba with existing genomic resources , have the potential to transform our understanding of how ndhA contributes to plant resilience under changing environmental conditions.

How might synthetic biology approaches enhance or modify ndhA function for improved plant performance?

Synthetic biology approaches offer exciting possibilities for enhancing or modifying ndhA function to improve plant performance:

  • Rational protein engineering: Using structural insights and computational design to modify ndhA amino acid sequences for enhanced stability under stress conditions or improved electron transfer efficiency.

  • Alternative NDH complex designs: Creating minimalist or hybrid NDH complexes incorporating modified ndhA variants alongside components from stress-tolerant organisms (extremophiles, stress-adapted algae).

  • Inducible expression systems: Developing stress-responsive promoter systems for ndhA that rapidly upregulate NDH complex assembly precisely when cyclic electron flow enhancement is most needed.

  • Subcellular targeting optimization: Refining chloroplast transit peptides to enhance ndhA import efficiency or strategic localization within thylakoid membrane domains.

  • Interspecies chimeric proteins: Creating chimeric ndhA proteins that incorporate functional domains from species adapted to extreme environments, potentially conferring enhanced stress tolerance.

These approaches could be particularly valuable for enhancing the climate resilience of economically important Populus species, which are increasingly utilized for bioenergy production, carbon sequestration, and ecosystem restoration projects in challenging environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.