Recombinant Populus alba NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Populus alba (White poplar)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWAFLIISSVIPILAFLISGLLSPIRKGPEKLSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILIVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. NDH couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of ndhC in Populus alba chloroplasts?

The ndhC gene in Populus alba encodes the NAD(P)H-quinone oxidoreductase subunit 3, a critical component of the NDH complex in chloroplasts. This complex participates in cyclic electron flow around photosystem I and chlororespiration. The NDH complex functions primarily in balancing the ATP/NADPH ratio during photosynthesis and aids in photoprotection under stress conditions. Within the chloroplast genome of Populus species, ndhC is located in a region that shows higher variability compared to other genes, making it one of the nine identified divergence hotspots that can serve as molecular markers for population genetic studies . The protein functions within a multisubunit complex that facilitates electron transfer from NAD(P)H to plastoquinone, contributing to proton gradient formation across the thylakoid membrane.

What techniques are commonly used to isolate native ndhC protein from Populus alba?

The isolation of native ndhC protein from Populus alba requires a multi-step approach:

  • Chloroplast isolation: Fresh leaf tissue (typically 10-20g) is homogenized in isolation buffer (0.33M sorbitol, 50mM HEPES-KOH pH 7.8, 2mM EDTA, 1mM MgCl₂, 1mM MnCl₂, 0.1% BSA) followed by filtration and differential centrifugation.

  • Thylakoid membrane preparation: Isolated chloroplasts are osmotically shocked in hypotonic buffer to release thylakoid membranes, which are then collected by centrifugation.

  • Membrane protein solubilization: Thylakoid membranes are solubilized using mild detergents (typically n-dodecyl β-D-maltoside at 1% w/v) to maintain protein complex integrity.

  • Protein complex separation: Blue-native PAGE or sucrose gradient ultracentrifugation is used to separate the intact NDH complex.

  • Subunit isolation: The ndhC subunit can be isolated from the complex using denaturing electrophoresis followed by electroelution or specialized chromatography methods.

What expression systems are most effective for producing recombinant P. alba ndhC protein?

For recombinant expression of Populus alba ndhC, researchers have explored several systems with varying degrees of success:

Expression SystemAdvantagesChallengesTypical Yield
E. coli- Rapid growth
- Simple genetic manipulation
- Low cost
- Lack of chloroplast-specific chaperones
- Protein often forms inclusion bodies
- No post-translational modifications
0.5-3 mg/L culture
Chloroplast transformation- Native-like environment
- Correct folding and assembly
- Functional integration
- Technical complexity
- Time-consuming
- Limited to model species
Variable, 2-5% of total soluble protein
Tobacco BY-2 cells- Plant-based system
- Post-translational modifications
- Secretion possible
- Slower growth
- More complex manipulation
- Higher cost
1-2 mg/L culture

What purification strategies yield the highest purity for recombinant ndhC protein?

Purification of recombinant Populus alba ndhC requires careful optimization to maintain protein integrity while achieving high purity. The most effective strategy involves:

  • Affinity chromatography: His-tagged ndhC proteins can be purified using Ni-NTA columns with imidazole gradient elution. Critical parameters include using low imidazole (5-10 mM) in wash buffers and a gradual elution gradient (20-250 mM) to separate the target protein from non-specific binders.

  • Ion exchange chromatography: DEAE or Q-Sepharose columns provide additional purification based on the protein's negative charge at physiological pH. A pH of 7.5-8.0 and salt gradient of 50-500 mM NaCl typically give optimal separation.

  • Size exclusion chromatography: Final polishing using Superdex 75 or 200 columns separates remaining contaminants and protein aggregates.

For membrane proteins like ndhC, maintaining a mild detergent (0.03-0.05% n-dodecyl β-D-maltoside) throughout purification is essential to prevent aggregation. Recent advances have shown that using lipid nanodiscs or amphipols during the final purification steps can significantly improve protein stability and functional integrity. Optimized protocols typically achieve >95% purity with yields of 0.5-1.5 mg from 1L of bacterial culture, although yield varies substantially depending on the expression system used .

How can researchers measure the enzymatic activity of recombinant ndhC in vitro?

Measuring the enzymatic activity of recombinant ndhC requires assessment within the context of the complete NDH complex, as the individual subunit lacks catalytic activity on its own. The following methodological approaches are recommended:

  • NADH/NADPH oxidation assay: This spectrophotometric method monitors the decrease in absorbance at 340 nm as NAD(P)H is oxidized. The reaction mixture typically contains 50 mM HEPES-KOH (pH 7.8), 100 μM NADH or NADPH, 100 μM plastoquinone (or analogs like decylubiquinone), and the purified protein or reconstituted complex.

  • Artificial electron acceptor assays: Using ferricyanide (K₃[Fe(CN)₆]) or dichlorophenolindophenol (DCPIP) as electron acceptors provides a more sensitive measurement of electron transport activity. The reduction of these compounds can be monitored spectrophotometrically at 420 nm and 600 nm, respectively.

  • Oxygen consumption measurements: Using an oxygen electrode, researchers can measure oxygen consumption rates in a reaction mixture containing the reconstituted NDH complex, NADH/NADPH, and appropriate electron acceptors.

  • EPR spectroscopy: This technique can be used to detect the formation of semiquinone intermediates during electron transport, providing insights into the mechanism of electron transfer.

When interpreting results, it's critical to include proper controls, particularly heat-inactivated enzyme preparations and reactions without substrate. Activity measurements should be conducted across different pH values (6.5-8.5) and temperatures (20-40°C) to determine optimal conditions. As demonstrated in studies of chloroplast proteins, environmental conditions can significantly influence protein activity, similar to how they affect DNA methylation patterns in Populus .

What approaches can be used to study the integration of recombinant ndhC into the NDH complex?

Studying the integration of recombinant ndhC into the NDH complex requires techniques that can assess protein-protein interactions and complex assembly:

  • Blue-Native PAGE: This technique separates native protein complexes and can visualize the incorporation of recombinant ndhC into the NDH complex. Subsequent western blotting with anti-ndhC antibodies confirms the presence of the protein within the complex.

  • Co-immunoprecipitation (Co-IP): Using antibodies against other NDH complex subunits to precipitate the complex, followed by western blotting for ndhC, can demonstrate interaction and incorporation.

  • Fluorescence resonance energy transfer (FRET): By tagging ndhC and other NDH subunits with appropriate fluorescent proteins, FRET can detect close association between proteins in vivo.

  • Sucrose gradient ultracentrifugation: This method separates protein complexes by size and can be used to isolate intact NDH complexes containing the recombinant ndhC protein.

  • Cryo-electron microscopy: For detailed structural analysis, cryo-EM can visualize the assembled complex and determine the position and orientation of ndhC within it.

For in vivo studies, chloroplast transformation in model systems (such as tobacco) with tagged versions of ndhC provides the most physiologically relevant information about complex assembly. This approach allows researchers to observe how genetic modifications to ndhC affect its incorporation into the complex and subsequent photosynthetic functions. Comparative studies across different Populus species can provide insights into how variations in the ndhC sequence influence complex assembly, similar to how cp genome comparative analyses have revealed conserved structures with specific variable regions .

How does the ndhC sequence vary across Populus species and populations?

Key patterns of variation include:

  • Single Nucleotide Polymorphisms (SNPs): The ndhC coding region contains several SNPs that differentiate between Populus species. These polymorphisms are typically synonymous substitutions that don't alter the amino acid sequence, preserving protein function while allowing for species identification.

  • Indels in the ndhC-trnV intergenic region: The non-coding region between ndhC and trnV shows insertion/deletion polymorphisms that vary between species and sometimes between populations of the same species.

  • Population-specific haplotypes: Studies of Populus population genetics have identified distinct chloroplast haplotypes, which include variations in the ndhC region. In P. adenopoda, for example, thirteen chloroplast haplotypes were detected across 39 populations, with haplotype-rich populations found in central and southern parts of the species' range .

  • Geographic distribution patterns: The distribution of ndhC variants often shows geographic structuring, reflecting historical migration patterns and population isolation events. In P. adenopoda, STRUCTURE analyses suggest lineage admixture, especially in peripheral and northern populations .

This genetic variation provides valuable markers for understanding the evolutionary history and population structure of Populus species, complementing epigenetic studies that have shown how environmental conditions influence DNA methylation patterns .

What are common challenges in expressing recombinant ndhC and how can they be overcome?

Researchers working with recombinant Populus alba ndhC encounter several technical challenges that require specific troubleshooting approaches:

ChallengeCauseSolution
Low expression levels- Codon bias
- Toxicity to host
- mRNA secondary structure
- Optimize codons for expression host
- Use inducible promoters with tight regulation
- Redesign 5' mRNA region to reduce secondary structure
Inclusion body formation- Improper folding
- Hydrophobic protein regions
- Expression rate too high
- Lower induction temperature (16-18°C)
- Add solubility tags (MBP, SUMO, Trx)
- Reduce inducer concentration
- Co-express with chloroplast chaperones
Protein instability- Proteolytic degradation
- Aggregation
- Oxidation
- Add protease inhibitors during purification
- Include mild detergents (0.03-0.05% DDM)
- Add reducing agents (5mM DTT or 2mM β-ME)
- Work at 4°C throughout purification
Poor incorporation into NDH complex- Missing assembly factors
- Improper subunit stoichiometry
- Missing lipid environment
- Use chloroplast-based expression systems
- Co-express with other NDH subunits
- Reconstitute in liposomes with chloroplast lipid composition

When working with bacterial expression systems, the inclusion of molecular chaperones (GroEL/ES, ClpB) can significantly improve the yield of correctly folded protein. For functional studies, expressing ndhC in chloroplast transformation systems using tobacco or Chlamydomonas provides a more native-like environment that contains the necessary assembly factors and lipid composition. This approach aligns with findings that environmental conditions strongly influence protein expression and activity in Populus species, similar to how they affect methylation patterns .

How can researchers validate that recombinant ndhC maintains native structure and function?

Validating the structural and functional integrity of recombinant ndhC requires a multi-faceted approach comparing the recombinant protein to native forms:

  • Structural validation techniques:

    • Circular dichroism (CD) spectroscopy to assess secondary structure composition

    • Limited proteolysis patterns compared between recombinant and native proteins

    • Thermal stability assays to measure protein unfolding temperatures

    • NMR or X-ray crystallography for detailed structural comparison when feasible

  • Functional validation methods:

    • Enzymatic activity assays comparing recombinant vs. native protein (NAD(P)H oxidation rates)

    • Reconstitution experiments with other NDH complex subunits

    • Complementation studies in ndhC-deficient systems

    • Electron transport measurements in reconstituted liposomes or thylakoid membranes

  • Interaction verification:

    • Pull-down assays with known ndhC interaction partners

    • Blue-Native PAGE to assess complex formation

    • Surface plasmon resonance to measure binding kinetics with other NDH subunits

  • In vivo validation:

    • Chloroplast transformation with recombinant ndhC to replace native gene

    • Phenotypic rescue assessment in ndhC mutants

    • Chlorophyll fluorescence measurements to assess NDH complex function

One critical validation approach involves comparing electron transport rates through the NDH complex using both recombinant and native preparations. Researchers should examine parameters including substrate affinity (Km), catalytic efficiency (kcat/Km), and response to inhibitors. Differences in these parameters may indicate structural alterations in the recombinant protein. Additionally, comparing the protein's stability and function across different environmental conditions (temperature, pH, light intensity) can reveal whether it maintains the native regulatory properties essential for in vivo function. This is particularly important given findings that environmental conditions influence functional properties of Populus proteins, similar to how they affect epigenetic patterns .

How can site-directed mutagenesis of ndhC inform our understanding of NDH complex function in photosynthesis?

Site-directed mutagenesis of Populus alba ndhC provides a powerful tool for dissecting the structure-function relationships within the NDH complex:

  • Conserved residue analysis: By aligning ndhC sequences across species, researchers can identify highly conserved amino acids likely crucial for function. Systematic mutation of these residues can reveal their specific roles in electron transport, complex assembly, or regulation.

  • Quinone binding site investigation: The NDH complex interacts with plastoquinone molecules, and mutations in putative quinone-binding regions of ndhC can help map this critical interaction site. Conservative substitutions (e.g., phenylalanine to tyrosine) can test the importance of specific chemical properties.

  • Subunit interface mapping: Mutations at predicted interaction surfaces between ndhC and other NDH subunits can disrupt complex assembly, revealing the architectural importance of specific residues.

  • Stress response elements: Creating mutations in regions hypothesized to be involved in stress-responsive regulation can help uncover how the NDH complex adapts to changing environmental conditions.

  • Post-translational modification sites: Mutating potential phosphorylation or other modification sites can elucidate regulatory mechanisms controlling NDH activity.

For meaningful interpretation of mutagenesis results, researchers should employ both in vitro biochemical assays and in vivo functional studies using chloroplast transformation systems. Comparing wild-type and mutant phenotypes under various stress conditions (high light, drought, temperature extremes) provides particularly valuable insights into the physiological role of specific ndhC features. This approach builds on observations that Populus species show variable responses to environmental conditions, which influence both genetic and epigenetic patterns .

What are the implications of ndhC variation for understanding Populus adaptation to different environments?

The variation in ndhC across Populus populations has significant implications for understanding adaptation to different environments:

  • Photosynthetic efficiency adaptation: Variations in ndhC may fine-tune cyclic electron flow efficiency for different light environments. Populations in high-light environments might benefit from enhanced NDH activity to provide photoprotection, while those in shade conditions might require different optimizations.

  • Drought tolerance mechanisms: The NDH complex contributes to photosynthetic resilience during drought stress. Sequence variations in ndhC could represent adaptations to different precipitation regimes across the geographic range of Populus.

  • Thermal adaptation: Different temperature optima for NDH activity could be shaped by ndhC variations that stabilize the complex at temperature extremes relevant to specific habitats.

  • Co-evolution with epigenetic regulation: The discovery that Populus populations show significant epigenetic variability despite limited genetic diversity suggests an interplay between genetic variation in genes like ndhC and epigenetic mechanisms that together facilitate environmental adaptation.

  • Population history markers: The ndhC-trnV region serves as one of nine identified divergence hotspots in Populus chloroplast genomes , providing valuable markers for tracking historical population movements and isolation events. Studies of P. adenopoda revealed that haplotype-rich populations were found in central and southern parts of the species' range , potentially indicating refugial areas during climate fluctuations.

Research investigating correlations between ndhC variants and environmental parameters across the Populus range could reveal specific adaptations. Combining genetic analyses with physiological measurements of photosynthetic performance under stress conditions would provide particularly valuable insights into how ndhC variation contributes to local adaptation. Such studies would complement findings that Populus species have experienced multiple demographic expansions and bottlenecks during climate fluctuations , potentially driving adaptive evolution in chloroplast genes.

What emerging technologies will advance research on chloroplast proteins like ndhC?

Several cutting-edge technologies are poised to transform research on chloroplast proteins including Populus alba ndhC:

These technologies will build upon the foundation of comparative genomics studies that have identified ndhC as part of a divergence hotspot in Populus chloroplast genomes , enabling more detailed investigations of how genetic variations influence protein function and adaptation.

How might understanding ndhC function contribute to improving photosynthetic efficiency in crops?

Understanding ndhC function in Populus alba has significant potential to contribute to agricultural improvements through several pathways:

  • Engineering enhanced photoprotection: The NDH complex plays a crucial role in photoprotection during high light stress. Knowledge gained from studying ndhC variants could inform engineering of crops with improved ability to manage excess light energy, reducing photoinhibition and maintaining productivity under fluctuating light conditions.

  • Improving drought resilience: The NDH complex contributes to maintaining photosynthetic efficiency under water limitation. Insights from ndhC functional studies could guide modifications to improve crop performance during drought periods, an increasingly important trait under climate change scenarios.

  • Temperature adaptation engineering: Understanding how ndhC variants function at temperature extremes could enable the development of crops with expanded temperature tolerance ranges, addressing challenges of global warming.

  • Optimizing carbon fixation pathways: The NDH complex influences the balance between cyclic and linear electron flow, which affects the ATP/NADPH ratio available for carbon fixation. Fine-tuning this balance through ndhC modifications could potentially enhance carbon fixation efficiency.

  • Leveraging natural variation: The identified divergence hotspots in chloroplast genomes, including the ndhC-trnV region , represent natural experiments in optimization for different environments. Screening diverse Populus populations could reveal naturally optimized variants for specific conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.