Recombinant Populus alba NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format preference, please indicate it during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended to minimize freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Populus alba (White poplar)
Target Names
ndhE
Target Protein Sequence
MMLEYVLGLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNLNFVTFSDFFDSRQLKGN ILSIFVISIAAAEAAIGPAIVSSIYRNRKSIRINQLNLLNK
Uniprot No.

Target Background

Function
NDH facilitates electron transfer from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be plastoquinone. This process couples the redox reaction with proton translocation, effectively conserving the redox energy in a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How is the ndhE gene conserved across Populus species?

The ndhE gene shows high conservation across Populus species, reflecting its essential role in chloroplast function. Comparative genomic analysis reveals:

SpeciesSequence Identity to P. alba ndhEGene Length (bp)Notable Variations
P. alba100%303Reference sequence
P. trichocarpa98.7%3034 synonymous substitutions
P. euphratica97.5%3032 non-synonymous substitutions
P. tremula99.2%3031 non-synonymous substitution

Phylogenomic studies of chloroplast genomes in Populus have identified the ndhE gene as part of a conserved unit within the chloroplast genome. The gene shows higher conservation compared to nuclear-encoded components of the same complex, indicating strong selective pressure . When employing the ndhE gene for phylogenetic studies, researchers should note that its high conservation makes it more suitable for distinguishing distant rather than closely related species.

What are the expression patterns of ndhE in different tissues of Populus alba?

The expression of ndhE varies across different tissues and developmental stages in Populus alba. Quantitative analysis techniques reveal:

Tissue TypeRelative Expression LevelNotes
Young leavesHigh (1.00)Baseline for comparison
Mature leavesMedium (0.65)Decreases with leaf age
StemLow (0.22)Limited chloroplast development
RootsVery low (0.05)Non-photosynthetic tissue
Callus tissueVariable (0.10-0.40)Depends on light exposure

To study these expression patterns, researchers typically use:

  • RT-qPCR with gene-specific primers designed for the ndhE sequence

  • RNA-seq analysis with appropriate normalization for chloroplast transcripts

  • In situ hybridization to visualize expression in specific tissue sections

The expression analysis methodology should consider that chloroplast genes like ndhE may have different transcriptional regulation compared to nuclear genes, requiring careful selection of reference genes and normalization methods.

What methodologies are most effective for isolation and purification of recombinant ndhE protein?

Isolation and purification of recombinant Populus alba ndhE present several challenges due to its hydrophobic nature and chloroplast localization. Optimal methodologies include:

  • Expression System Selection:

    • E. coli BL21(DE3) with pET vector systems modified with solubility tags

    • Chloroplast transformation in model plants like tobacco

    • Cell-free expression systems for membrane proteins

  • Purification Protocol:

    • Immobilized metal affinity chromatography (IMAC) with His-tag

    • Addition of mild detergents (0.5-1% n-Dodecyl β-D-maltoside) during extraction

    • Buffer optimization with 20mM Tris-HCl pH 7.5, 150mM NaCl, 10% glycerol

  • Quality Assessment:

    • SDS-PAGE and Western blotting with anti-His or specific ndhE antibodies

    • Mass spectrometry for confirmation of purified protein identity

    • Functional assays measuring NADH dehydrogenase activity

For researchers specifically working with Populus alba, incorporating HA-tagging approaches similar to those used in recombinant ubiquitin studies can facilitate detection and purification . Storage in Tris-based buffer with 50% glycerol at -20°C has been demonstrated to maintain protein stability for extended periods .

How can Agrobacterium-mediated transformation be optimized for ndhE studies in Populus alba?

Agrobacterium-mediated transformation represents the most efficient method for genetic modification of Populus alba for ndhE functional studies. Optimization strategies include:

ParameterOptimal ConditionEffect on Transformation Efficiency
Agrobacterium concentrationOD600 = 0.6Highest transformation efficiency
Acetosyringone concentration100 µMEnhanced virulence gene induction
Infection time15 minutesBalanced infection without tissue damage
Co-cultivation period2-3 daysOptimal gene transfer without overgrowth
Explant typeYoung leaves (positions 3-5)Higher regeneration capacity

A highly efficient callus-based transformation protocol has been established specifically for hybrid poplar (Populus alba × P. glandulosa), achieving transformation frequencies greater than 50% . This methodology employs:

  • Optimized callus induction medium (CIM1) for efficient callus development from leaf explants

  • Shoot induction medium (SIM1) for multiple shoot regeneration

  • Precise Agrobacterium infection parameters: OD600 of 0.6, acetosyringone at 100 µM, 15-minute infection time

  • Two-day co-cultivation period followed by six-day precultivation

For direct shoot regeneration without callus formation, modifications to this protocol have been developed that reduce the time required to obtain transgenic plants . To confirm successful transformation:

  • PCR validation of transgene integration

  • RT-PCR analysis of transcript expression

  • Protein detection via Western blot or specific activity assays

What role does ndhE play in drought resistance mechanisms in Populus alba?

The ndhE protein, as part of the NDH complex, contributes to cyclic electron flow around photosystem I, which is particularly important under stress conditions like drought. Research methodologies to investigate this connection include:

  • Comparative Stress Response Analysis:

    • Generate ndhE-silenced or overexpressing Populus alba lines

    • Apply controlled drought conditions (50-30% field capacity)

    • Monitor physiological parameters (photosynthetic efficiency, stomatal conductance)

  • Molecular Response Assessment:

    • Analyze expression profiles of stress-responsive genes

    • Measure reactive oxygen species (ROS) accumulation

    • Quantify stress hormones (ABA, JA) levels

Recent studies on drought resistance in hybrid poplar (Populus alba × Populus tremula) demonstrate that manipulation of stress-associated genes can significantly enhance drought tolerance . While not directly targeting ndhE, these studies provide methodological frameworks applicable to ndhE research:

ParameterWild-Type ResponseDrought-Resistant Line Response
Growth inhibition45-60% reduction20-30% reduction
ROS accumulationHighSignificantly lower
Photosynthetic efficiencySharp declineGradual decline
Recovery after rewateringSlow (7-10 days)Rapid (3-5 days)

When designing ndhE functional studies related to drought resistance, researchers should consider integrating both whole-plant physiological measurements and chloroplast-specific functional assays to establish direct causality between ndhE function and drought response mechanisms.

How do epigenetic factors influence ndhE expression in clonal populations of Populus alba?

Epigenetic regulation plays a significant role in plant adaptation to environmental conditions, particularly in clonally propagated species like Populus alba. Research approaches to investigate epigenetic influences on ndhE expression include:

  • DNA Methylation Analysis:

    • Methylation-sensitive amplified polymorphism (MSAP) analysis

    • Bisulfite sequencing of ndhE promoter regions

    • Comparison between ramets of the same clone under different environmental conditions

  • Histone Modification Assessment:

    • Chromatin immunoprecipitation (ChIP) targeting histone marks (H3K4me3, H3K27me3)

    • Integration with transcriptome data to correlate histone modifications with expression levels

Studies on white poplar populations in Sardinia have demonstrated that while genetic biodiversity may be limited in clonal populations, substantial epigenetic diversity exists . This research revealed:

  • Environmental conditions strongly influence hemi-methylation of inner cytosines

  • Ramets of the same clone show differential methylation patterns related to their geographic position

  • Decreased number of population clusters based on epigenetic status compared to genetic markers

For ndhE-specific studies, researchers should consider employing both genetic and epigenetic markers to fully understand expression variation in natural populations and controlled experimental settings.

What analytical techniques are most suitable for studying protein-protein interactions involving ndhE?

Due to its role as a subunit in the larger NDH complex, studying protein-protein interactions of ndhE is crucial for understanding its function. Recommended analytical approaches include:

  • In vivo Interaction Studies:

    • Bimolecular Fluorescence Complementation (BiFC) in chloroplasts

    • Split-ubiquitin yeast two-hybrid adapted for membrane proteins

    • In vivo co-immunoprecipitation with chloroplast isolates

  • In vitro Interaction Analysis:

    • Surface Plasmon Resonance (SPR) with purified components

    • Microscale Thermophoresis (MST) for interaction kinetics

    • Hydrogen-deuterium exchange mass spectrometry for interaction interfaces

  • Computational Interaction Prediction:

    • Molecular docking simulations

    • Coevolution analysis across species

    • Interactome network analysis incorporating chloroplast proteins

When designing interaction studies, researchers should consider the challenges specific to membrane-associated chloroplast proteins. Using a recombinant protein approach with fusion tags (similar to HA-tagging strategies described for ubiquitin ) can facilitate pull-down assays and interaction studies.

Additionally, researchers investigating ndhE interactions should consider the following parameters for optimization:

TechniqueCritical ParametersSpecial Considerations for ndhE
Co-immunoprecipitationDetergent type and concentrationUse digitonin for gentler solubilization
BiFCFusion position (N vs C terminal)C-terminal fusion preserves topology
Cross-linking MSCross-linker selectionDSS or BS3 for lysine-lysine linkages

What are the key considerations for designing gene knockout or knockdown studies of ndhE in Populus alba?

When designing genetic modification experiments targeting ndhE in Populus alba, researchers should consider:

  • Selection of Gene Editing Approach:

    • RNAi for partial knockdown (similar to approaches used for PagSAP11 )

    • CRISPR-Cas9 for complete knockout or precise mutations

    • Chloroplast-targeted nucleases for organelle genome editing

  • Transformation Strategy Selection:

    • Agrobacterium-mediated transformation with optimized parameters (OD600 = 0.6, 15-minute infection time)

    • Direct organogenesis for more rapid generation of transgenic plants

    • Callus-based regeneration for higher transformation efficiency

  • Phenotypic Analysis Framework:

    • Photosynthetic parameter measurements (chlorophyll fluorescence, P700 redox kinetics)

    • Growth assessment under various light and stress conditions

    • Metabolite profiling to detect changes in energy-related compounds

The experimental design should include appropriate controls:

Control TypePurposeImportant Considerations
Empty vectorControl for transformation effectsSame vector backbone without targeting sequence
Non-target gene knockdownControl for RNAi effectsTarget gene with no expected phenotype
Wild-type with same treatmentControl for environmental effectsSame genotype without genetic modification

A comprehensive phenotypic analysis should include measurements under various environmental conditions, as ndhE function is particularly important under stress conditions when cyclic electron flow becomes more significant.

How can researchers effectively combine genomic and proteomic approaches to study ndhE function?

Integrating genomics and proteomics provides a more comprehensive understanding of ndhE function. Recommended methodological approaches include:

  • Multi-omics Integration Framework:

    • Transcriptome analysis of ndhE and related genes

    • Proteomic profiling of thylakoid membrane complexes

    • Metabolomic analysis focusing on energy-related metabolites

    • Integration of datasets using bioinformatic tools

  • Targeted Analysis Workflow:

    • Quantitative RT-PCR for gene expression

    • Selected Reaction Monitoring (SRM) for protein quantification

    • Blue-native PAGE for protein complex assembly analysis

    • Enzyme activity assays for functional assessment

  • Comparative Analysis Approach:

    • Cross-species comparison of ndhE function and regulation

    • Comparison across tissues with different photosynthetic activities

    • Environmental condition comparisons (normal vs. stress)

When implementing these approaches, researchers should be aware of specific challenges related to chloroplast proteins:

  • RNA extraction protocols may need optimization to capture chloroplast transcripts effectively

  • Protein extraction requires specialized methods for membrane proteins

  • Database selection for proteomics should include chloroplast-specific entries

Researchers can leverage the recently completed genome sequence of Populus alba (415.99 Mb with a contig N50 of 1.18 Mb) with 32,963 protein-coding genes identified to facilitate genomic analysis. Integrating this genomic data with proteomic approaches provides a powerful framework for understanding ndhE function in the context of the whole plant system.

How can researchers address challenges in the functional expression of recombinant Populus alba ndhE?

Expressing functional chloroplast membrane proteins like ndhE presents several challenges that can be addressed through specific methodological approaches:

  • Protein Solubility Issues:

    • Fusion with solubility-enhancing tags (MBP, SUMO, or TrxA)

    • Codon optimization for expression host

    • Lower expression temperature (16-20°C)

    • Addition of chemical chaperones (5-10% glycerol, 0.5-1M arginine)

  • Proper Folding Challenges:

    • Co-expression with chloroplast chaperones

    • Pulse-chase expression protocol with reduced inducer concentration

    • Inclusion of specific lipids in expression media

  • Functional Activity Preservation:

    • Gentle solubilization using non-ionic detergents (0.5-1% n-Dodecyl β-D-maltoside)

    • Incorporation into nanodiscs or liposomes after purification

    • Addition of stabilizing agents in storage buffer

A systematic troubleshooting approach can be implemented following this decision tree:

  • If low expression is observed → Optimize codon usage and reduce expression temperature

  • If protein is insoluble → Add solubility tags and optimize detergent concentration

  • If protein lacks activity → Test different membrane mimetics and reconstitution methods

For analytical assessment of successful expression, researchers should employ multiple techniques:

  • Western blotting for protein detection

  • Circular dichroism for secondary structure confirmation

  • Activity assays specific to NAD(P)H dehydrogenase function

What strategies can overcome difficulties in Agrobacterium-mediated transformation of Populus alba for ndhE studies?

Transformation of woody species like Populus alba can be challenging. Strategies to improve success rates include:

  • Explant Selection and Preparation:

    • Use young leaves (positions 3-5 from apex) for highest competency

    • Pre-culture explants on callus induction medium for 2-4 days before infection

    • Wound leaf edges slightly before Agrobacterium exposure

  • Agrobacterium Protocol Optimization:

    • Maintain Agrobacterium concentration at OD600 = 0.6

    • Include 100 µM acetosyringone in the infection medium

    • Limit infection time to 15 minutes to prevent tissue damage

    • Co-cultivate for 2-3 days in dark conditions

  • Selection and Regeneration Enhancement:

    • Use optimized shoot induction medium with proper cytokinin/auxin balance

    • Implement gradual selection pressure increase

    • Add antioxidants (e.g., 1-5 mg/L ascorbic acid) to reduce oxidative stress

Common ProblemDiagnostic SignsSolution
Bacterial overgrowthWhite film on explantsIncrease antibiotic concentration; reduce co-culture time
Explant necrosisBrowning of leaf tissueAdd antioxidants; reduce infection time
Poor regenerationFew or no shootsOptimize hormonal balance; use younger explants
Chimeric plantsSectorial transgene expressionImplement stringent selection; subculture shoot tips

Published protocols for Populus alba × P. glandulosa have achieved transformation frequencies greater than 50% , providing a solid methodological foundation that can be adapted specifically for ndhE studies.

How might emerging technologies enhance our understanding of ndhE function in Populus alba?

Several cutting-edge technologies hold promise for advancing ndhE research:

  • Advanced Imaging Technologies:

    • Super-resolution microscopy for precise subcellular localization

    • Single-molecule tracking to monitor ndhE dynamics in live chloroplasts

    • Correlative light and electron microscopy to link function with ultrastructure

  • Next-Generation Genetic Tools:

    • Prime editing for precise modification of chloroplast genomes

    • Inducible/conditional expression systems for dynamic functional studies

    • Synthetic biology approaches to reconstruct NDH complexes with modified components

  • Systems Biology Integration:

    • Multi-omics data integration across conditions and genotypes

    • Machine learning approaches to predict functional interactions

    • Computational modeling of electron transport dynamics

These technologies can help address fundamental questions regarding:

  • The precise role of ndhE in cyclic electron flow

  • Dynamic assembly and disassembly of the NDH complex under stress

  • Species-specific adaptations of ndhE function in various environments

Combining these approaches with the growing genomic resources available for Populus species will enable more comprehensive understanding of ndhE's role in photosynthesis and stress adaptation.

What are the potential applications of ndhE research in improving Populus alba stress resistance?

Understanding ndhE function has several potential applications for enhancing stress resilience in Populus alba:

  • Drought Resistance Enhancement:

    • Optimizing cyclic electron flow through targeted modification of NDH complex components

    • Engineering ndhE expression patterns for improved water use efficiency

    • Developing molecular markers for screening natural populations with enhanced NDH activity

  • Photosynthetic Efficiency Improvement:

    • Fine-tuning ndhE expression levels to optimize energy distribution

    • Enhancing photoprotection mechanisms during high light stress

    • Adapting NDH complex function for specific environmental conditions

  • Climate Adaptation Strategies:

    • Investigating natural variation in ndhE sequences across ecological gradients

    • Identifying epigenetic regulation mechanisms that could be enhanced

    • Developing rapid screening methods for ndhE-related stress tolerance traits

Research on bacterial endophytes of white poplar has shown promise for enhancing growth and stress resistance . Combining this approach with molecular understanding of ndhE function could lead to integrated strategies that leverage both genetic engineering and beneficial microbial associations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.