Recombinant Populus alba Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant psbB protein is produced in Escherichia coli with an N-terminal His-tag for purification.

Functional Analysis

  • PSII Assembly: Investigated alongside CPRabA5e, a protein involved in LHCB1/LHCB3 transport, to elucidate assembly pathways .

  • Mutant Studies: Knockout mutants in Arabidopsis and Chlamydomonas highlight psbB’s role in PSII dimerization and supercomplex formation .

Biotechnological Uses

  • Antibody Production: Serves as an antigen in ELISA kits for detecting psbB in plant extracts .

  • Stress Tolerance: Used to study PSII repair mechanisms under high light intensity or oxidative stress .

Comparative Insights: Populus alba vs. Model Organisms

While psbB is conserved across plants, Populus alba’s genome reveals unique adaptations:

FeaturePopulus albaArabidopsis thaliana
Genome ContextHigh collinearity with Populus trichocarpa; diverged ~13 Mya .Standard model for PSII studies .
Auxiliary ProteinsCPRabA5e implicated in LHCB transport .Thylakoid-localized enzymes for PSII repair .
Ecological RelevanceTolerates riparian environments and salinity .Laboratory-controlled conditions.

Challenges and Future Directions

  • Stability Issues: Lyophilized psbB requires careful handling to prevent aggregation .

  • Functional Mimicry: Challenges in replicating native PSII supercomplexes in vitro .

  • Cropping Applications: Potential for engineering psbB variants to enhance photosynthetic efficiency in Populus species .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your preferred format in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please inform us in advance and expect additional fees.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form maintains stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development of the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Populus alba (White poplar)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGTGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAIGWLGHPLFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGSRTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV
Uniprot No.

Target Background

Function
CP47 (chlorophyll apoprotein), encoded by the psbB gene, is a core component of Photosystem II (PSII). It binds chlorophyll and plays a crucial role in catalyzing the initial light-induced photochemical reactions within PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, harnessing light energy to extract electrons from H2O, producing O2 and a proton gradient that ultimately drives ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is CP47 chlorophyll apoprotein and what is its functional significance in Photosystem II?

CP47, encoded by the psbB gene, is a chlorophyll-binding protein that serves as an integral component of Photosystem II (PSII), the enzyme complex responsible for water-splitting and oxygen evolution during photosynthesis. Structurally, CP47 contains six transmembrane helical domains that form the core antenna system of PSII. The protein binds approximately 16 chlorophyll molecules and several carotenoids that function in light harvesting and energy transfer to the reaction center .

The evolutionary significance of CP47 lies in its structural relationship to CP43 (another PSII protein) and to the N-terminal domains of PsaA and PsaB proteins in Photosystem I. This structural conservation across different photosynthetic protein complexes indicates the fundamental importance of this architectural motif in photosynthesis .

In the context of Populus alba specifically, CP47 maintains these core functions while potentially exhibiting species-specific adaptations that may contribute to the photosynthetic efficiency and environmental adaptability of poplar trees.

How is the psbB gene organized in the Populus alba genome?

The psbB gene in Populus alba is part of the highly conserved chloroplast genome. While specific details about psbB organization in P. alba are not directly addressed in the search results, insights can be drawn from the genomic analysis of related Populus hybrids.

The genome of Populus alba × P. tremula var. glandulosa has been sequenced and assembled at the chromosome level, with a contig N50 size of 1.99 Mb and a scaffold N50 size of 19.6 Mb . The complete chloroplast genome was assembled as part of this project, which would include the psbB gene .

In the hybrid poplar genome, researchers were able to distinguish between the two parental subgenomes, with approximately 356 Mb from P. alba (designated as subgenome A) and 354 Mb from P. tremula var. glandulosa (designated as subgenome G) . This genomic architecture provides important context for understanding the organization and potential regulatory differences of chloroplast-encoded genes like psbB across Populus species and hybrids.

What are the recommended protocols for isolating and purifying recombinant CP47 protein from Populus alba?

Isolation and purification of recombinant CP47 from Populus alba requires specialized protocols due to the membrane-bound nature of this chlorophyll-binding protein. The following methodological approach is recommended:

Step 1: Expression System Selection

  • Establish a recombinant expression system using Agrobacterium-mediated transformation of Populus alba tissues .

  • Consider using the CsVMV promoter for high-level expression, as this has been successfully employed for other Populus proteins .

Step 2: Tissue Processing and Membrane Isolation

  • Harvest transformed plant tissues (preferably young leaves with high chloroplast content).

  • Homogenize tissue in extraction buffer containing:

    • 50 mM HEPES-KOH (pH 7.5)

    • 330 mM sorbitol

    • 2 mM EDTA

    • 1 mM MgCl₂

    • 5 mM ascorbate

    • Protease inhibitor cocktail

Step 3: Thylakoid Membrane Isolation

  • Filter homogenate through miracloth

  • Centrifuge at 300×g for 1 minute to remove debris

  • Centrifuge filtrate at 5,000×g for 10 minutes

  • Resuspend chloroplast pellet in osmotic shock buffer

  • Centrifuge at 12,000×g for 10 minutes to isolate thylakoid membranes

Step 4: Detergent Solubilization and Purification

  • Solubilize membrane proteins using mild detergents (0.8-1% β-dodecyl maltoside)

  • Purify using immobilized metal affinity chromatography (if His-tagged) or other appropriate affinity tags

  • Further purify using size exclusion chromatography

This protocol can be adapted from methods used for other recombinant membrane proteins in Populus species, though special care must be taken to maintain the native conformation and chlorophyll association of CP47 during the purification process.

What subcellular localization techniques are most effective for studying CP47 protein in Populus species?

Subcellular localization of CP47 and other chloroplast proteins in Populus species can be effectively studied using several complementary approaches:

A. Protoplast-based transient expression system:
This approach has been successfully employed for localization studies in Populus alba × P. glandulosa, as described in the literature . The protocol involves:

  • Isolating protoplasts from Populus leaves following the protocol described by Wu et al. (2009) .

  • Creating fusion constructs with CP47 and fluorescent reporter proteins (e.g., GFP).

  • Transforming the constructs into protoplasts using polyethylene glycol-mediated transient expression .

  • Visualizing the subcellular localization using confocal laser scanning microscopy .

B. Agrobacterium-mediated transient expression in Nicotiana benthamiana:
This alternative approach involves:

  • Constructing fusion proteins with CP47 and GFP.

  • Introducing the construct into Agrobacterium tumefaciens.

  • Infiltrating A. tumefaciens strains into N. benthamiana leaves.

  • Incubating for 24-48 hours before observing GFP fluorescence using confocal microscopy .

C. Stable transformation and in vivo imaging:
For long-term studies, stable transformation of Populus with CP47-fluorescent protein fusions can be achieved using established Agrobacterium-mediated transformation protocols for hybrid poplar .

The choice between these techniques depends on research goals, with protoplast systems offering rapid results and stable transformants providing opportunities for developmental and stress-response studies. For CP47 specifically, researchers should be aware that as a chloroplast protein, it should localize to chloroplast membranes, and appropriate chloroplast markers should be included as controls.

How can qRT-PCR be optimized for accurate quantification of psbB gene expression in Populus alba?

Optimizing qRT-PCR for accurate quantification of psbB expression in Populus alba requires careful attention to several methodological aspects:

RNA Isolation Protocol:

  • Extract total RNA from Populus tissues using a specialized plant RNA isolation kit such as the RNeasy Plant Mini Kit (Qiagen) .

  • Treat RNA samples with DNase to eliminate genomic DNA contamination.

  • Assess RNA quality using spectrophotometry (A260/A280 ratio) and integrity via gel electrophoresis.

Primer Design Considerations:

  • Design primers specific to the psbB gene sequence of Populus alba using programs like Primer3 .

  • Optimal primer characteristics:

    • Length: 18-25 nucleotides

    • GC content: 40-60%

    • Melting temperature: 58-62°C

    • Amplicon size: 80-150 bp for efficient amplification

  • Verify primer specificity through in silico analysis and experimental validation.

Reference Gene Selection:
Select appropriate reference genes for normalization. Based on studies in Populus species, suitable reference genes might include:

  • Actin

  • Ubiquitin

  • Elongation factor 1-α

  • GAPDH

qRT-PCR Protocol:

  • Synthesize first-strand cDNA using a commercial kit such as EcoDry premix (Takara) .

  • Perform qRT-PCR using SYBR Green PCR Master Mix on a real-time PCR system .

  • Include technical replicates (minimum of three) and biological replicates (minimum of three).

  • Include no-template and no-reverse-transcriptase controls.

Data Analysis:

  • Calculate relative expression using the 2^-ΔΔCt method as described by Livak and Schmittgen (2001) .

  • Perform statistical analysis to assess significance of expression differences.

  • Consider potential variability sources as discussed in statistical analysis literature .

This methodological approach ensures robust quantification of psbB expression across different tissues or experimental conditions in Populus alba.

What strategies can be employed to study CP47 protein interactions in the Photosystem II complex of Populus alba?

Investigating CP47 protein interactions within the Photosystem II complex requires specialized approaches that maintain the integrity of membrane protein complexes. Several complementary strategies are recommended:

A. Co-immunoprecipitation with Mild Detergent Solubilization:

  • Solubilize thylakoid membranes with gentle detergents (0.5-1% digitonin or n-dodecyl-β-D-maltoside)

  • Perform pull-down assays using antibodies against CP47 or epitope-tagged recombinant CP47

  • Identify interacting partners via mass spectrometry

B. Split-GFP or FRET-based Interaction Assays:
These approaches can be implemented in Populus protoplasts using the PEG-mediated transformation system described for other proteins :

  • Create fusion constructs of CP47 and potential interacting partners with split fluorescent proteins

  • Transform constructs into Populus protoplasts

  • Analyze reconstituted fluorescence using confocal microscopy

  • Quantify interaction strength through fluorescence intensity measurements

C. Bimolecular Fluorescence Complementation (BiFC):
BiFC represents another in vivo approach that could be adapted to Populus systems:

  • Fuse CP47 and candidate interactors to complementary fragments of a fluorescent protein

  • Express in Populus protoplasts or through Agrobacterium-mediated transformation

  • Visualize interaction-dependent fluorescence using confocal microscopy

D. Chemical Cross-linking Coupled with Mass Spectrometry:
This technique is particularly valuable for capturing transient interactions:

  • Treat isolated thylakoid membranes with membrane-permeable cross-linkers

  • Digest cross-linked proteins after purification

  • Identify cross-linked peptides using specialized mass spectrometry methods

E. Yeast Two-Hybrid Adaptations:
While challenging for membrane proteins, modified Y2H systems could be considered:

  • Use split-ubiquitin yeast two-hybrid systems designed for membrane proteins

  • Focus on soluble domains of CP47 for conventional Y2H

The choice of technique depends on specific research questions, with combinations of approaches providing the most comprehensive understanding of CP47's interaction network in Populus alba.

How can genomic and transcriptomic analyses be integrated to understand psbB regulation in different Populus alba tissues?

Integrating genomic and transcriptomic approaches provides powerful insights into the regulation of psbB across different tissues in Populus alba. Based on the available search results and contemporary research approaches, the following methodological framework is recommended:

Step 1: Genomic Context Analysis

  • Leverage the high-quality genome assembly available for Populus hybrids (e.g., poplar 84K with contig N50 of 1.99 Mb) .

  • Identify the precise genomic location of psbB and analyze its promoter region.

  • Perform comparative genomic analysis between Populus alba and related species to identify conserved regulatory elements.

Step 2: Tissue-Specific Transcriptome Profiling

  • Collect RNA from multiple tissues (e.g., leaves, stems, roots) as demonstrated in previous Populus studies .

  • Perform RNA-seq with sufficient depth (≥30 million reads per sample).

  • Apply standardized bioinformatic pipelines for read mapping and expression quantification.

Step 3: Differential Expression Analysis

  • Identify tissue-specific expression patterns of psbB.

  • Compare expression levels across developmental stages and environmental conditions.

  • Apply appropriate statistical methods to account for experimental variability .

Step 4: Identification of Regulatory Networks

  • Perform co-expression analysis to identify genes with similar expression patterns to psbB.

  • Conduct promoter analysis to identify potential transcription factor binding sites.

  • Utilize transcription factor databases to identify candidates for experimental validation.

Step 5: Integration with Functional Studies

  • Utilize transformation protocols established for Populus species to validate regulatory elements.

  • Consider the subgenome-specific expression biases observed in hybrid poplars when interpreting regulatory patterns.

This integrated approach provides a comprehensive framework for understanding the tissue-specific regulation of psbB in Populus alba, with applications extending to other photosynthetic genes.

What are the key considerations for designing CRISPR-Cas9 editing of the psbB gene in Populus alba?

CRISPR-Cas9 editing of the psbB gene in Populus alba requires careful design considerations due to the essential nature of this photosynthetic gene and the complexities of working with tree species. Here are the key methodological considerations:

Target Site Selection:

  • Analyze the psbB sequence for optimal gRNA target sites with:

    • Minimal off-target potential across the Populus genome

    • Appropriate PAM sites (NGG for SpCas9)

    • Target regions that avoid highly conserved functional domains if partial function is desired

  • Consider targeting non-coding regions for expression modulation rather than coding regions for functional knockouts, as complete loss of CP47 would likely be lethal.

Delivery System Optimization:

  • Utilize Agrobacterium-mediated transformation, which has been demonstrated as effective for Populus alba hybrids .

  • Consider tissue-specific promoters if constitutive editing would be detrimental.

  • Design a transformant selection strategy compatible with Populus regeneration protocols.

Editing Strategy Selection:

Editing ApproachApplicationAdvantagesLimitations
KnockoutFunctional studiesComplete loss of functionPotentially lethal for essential genes
Base editingSpecific amino acid changesPrecise modifications without DSBsLimited to certain substitutions
Prime editingSpecific sequence changesGreater precision and flexibilityLower efficiency in plants
Transcriptional modulation (CRISPRi/a)Expression studiesMaintains gene integrity while altering expressionIncomplete repression/activation

Regeneration and Validation:

  • Optimize tissue culture and regeneration protocols specific to Populus alba.

  • Implement sensitive detection methods for edited events:

    • PCR-based genotyping

    • Targeted sequencing

    • Phenotypic screening for photosynthetic parameters

  • Analyze potential off-target effects through whole-genome sequencing.

Phenotypic Analysis:

  • Measure photosynthetic parameters (e.g., oxygen evolution, chlorophyll fluorescence).

  • Assess plant growth and development under various conditions.

  • Evaluate stress responses in edited lines.

This comprehensive approach addresses the technical challenges of CRISPR editing in Populus while acknowledging the critical importance of the psbB gene in photosynthetic function.

What are common challenges in expressing functional recombinant CP47 protein and how can they be overcome?

Expressing functional recombinant CP47 presents several challenges due to its nature as a membrane-bound chlorophyll-binding protein. Here are the major challenges and recommended solutions:

Challenge 1: Proper Membrane Integration
CP47 contains six transmembrane domains that must be correctly inserted into membranes.

Solutions:

  • Use chloroplast-targeting transit peptides to ensure proper localization

  • Consider chloroplast transformation systems rather than nuclear expression

  • If using heterologous systems, include appropriate membrane-integration sequences

Challenge 2: Chlorophyll Binding
Functional CP47 must bind multiple chlorophyll molecules.

Solutions:

  • Express CP47 in photosynthetic organisms where chlorophyll synthesis machinery is present

  • Supplement expression media with chlorophyll precursors

  • Optimize light conditions during expression to promote chlorophyll synthesis

Challenge 3: Protein Stability
Membrane proteins are often prone to misfolding and degradation.

Solutions:

  • Express at lower temperatures (16-22°C) to slow folding and reduce aggregation

  • Include stabilizing agents in extraction buffers (glycerol, specific detergents)

  • Consider fusion with stability-enhancing tags that can be later removed

Challenge 4: Low Expression Yields
Complex membrane proteins often express at low levels.

Solutions:

  • Optimize codon usage for Populus expression systems

  • Consider using strong tissue-specific promoters

  • Test various Populus genotypes for expression efficiency, as transformation efficiency varies across genotypes

Challenge 5: Functional Validation
Confirming that recombinant CP47 retains native function can be difficult.

Solutions:

  • Develop complementation assays using mutant lines

  • Perform spectroscopic analyses to confirm proper chlorophyll binding

  • Assess protein-protein interactions with known partners in PSII

These methodological approaches address the major challenges in producing functional recombinant CP47 protein while maintaining its structural and functional integrity.

How can researchers minimize variability in experimental results when studying psbB gene expression in Populus?

Minimizing variability in psbB expression studies requires rigorous experimental design and statistical approaches. Based on principles of experimental design and statistical analysis , researchers should implement the following strategies:

A. Biological Sample Considerations:

  • Use genetically uniform plant material (clonal propagation is advantageous in Populus research).

  • Standardize plant age, leaf position, and developmental stage across experiments.

  • Control environmental conditions rigorously (light intensity, photoperiod, temperature, humidity).

  • Collect samples at consistent times of day to account for circadian regulation.

B. Experimental Design Principles:

  • Include sufficient biological replicates (minimum of 5-6 independent plants).

  • Employ randomized block designs to account for spatial variability in growth chambers/greenhouses.

  • Include appropriate technical replicates for each biological sample.

  • Use power analysis to determine appropriate sample sizes for detecting anticipated effect sizes .

C. Statistical Analysis Approaches:

  • Assess data for normality and homogeneity of variance before selecting statistical tests.

  • Apply appropriate transformations if necessary to meet assumptions of parametric tests.

  • Use mixed-effects models to account for nested sources of variation.

  • Consider the importance of variability in interpretation as discussed in statistical analysis literature :

    • High variability may mask treatment effects

    • Identifying sources of variability can improve experimental sensitivity

D. Technical Considerations for Gene Expression Analysis:

  • Standardize RNA extraction protocols across samples.

  • Use consistent reference genes validated for stability in Populus under your experimental conditions.

  • Include inter-run calibrators when qPCR must be performed across multiple plates.

  • Apply the 2^-ΔΔCt method consistently for relative quantification .

E. Data Reporting Standards:

  • Report all experimental conditions in detail to enhance reproducibility.

  • Include measures of variability (standard deviation or standard error) with all data points.

  • Clearly state sample sizes and statistical tests applied.

By implementing these methodological approaches, researchers can significantly reduce unwanted variability in psbB expression studies in Populus alba, increasing the reliability and reproducibility of their findings.

What quality control measures are essential for ensuring the integrity of isolated chlorophyll-protein complexes from Populus alba?

Ensuring the integrity of isolated chlorophyll-protein complexes, particularly CP47, from Populus alba requires comprehensive quality control measures throughout the isolation and analysis process:

1. Pre-extraction Quality Controls:

  • Harvest tissue at consistent developmental stages and times of day

  • Process samples immediately or flash-freeze in liquid nitrogen

  • Protect samples from light exposure during handling to prevent photooxidation

  • Maintain cold chain throughout the extraction process

2. Extraction Buffer Optimization:

  • Include multiple protease inhibitors to prevent degradation

  • Add antioxidants (e.g., ascorbate, DTT) to prevent oxidative damage

  • Maintain appropriate pH (typically 7.0-7.5) and ionic strength

  • Use glycerol or sucrose to stabilize protein complexes

3. Spectroscopic Analysis:

  • Measure absorption spectra (400-700 nm) to confirm chlorophyll association

    • Intact CP47 should show characteristic peaks at approximately 435 and 675 nm

  • Perform fluorescence emission spectroscopy at 77K to assess energy coupling

  • Calculate chlorophyll a/b ratios as indicators of complex integrity

4. Protein Characterization:

  • Verify protein size and purity using SDS-PAGE

  • Confirm identity via western blotting with CP47-specific antibodies

  • Assess native complex integrity using blue-native PAGE

  • Quantify total protein and chlorophyll content using standard methods

5. Functional Assays:

  • Measure oxygen evolution capacity if testing whole PSII preparations

  • Perform chlorophyll fluorescence induction to assess PSII functionality

  • Conduct energy transfer measurements to confirm intact antenna function

6. Advanced Structural Validation:

  • Use negative staining electron microscopy to confirm complex architecture

  • Apply dynamic light scattering to assess size distribution and aggregation

  • Consider limited proteolysis followed by mass spectrometry to confirm structural integrity

7. Storage Validation:

  • Test stability under various storage conditions (temperature, buffer composition)

  • Perform functional assays before and after storage to quantify activity loss

  • Establish maximum storage duration guidelines based on quality metrics

These methodological approaches provide a comprehensive quality control framework for ensuring the structural and functional integrity of isolated chlorophyll-protein complexes from Populus alba.

How are comparative genomics approaches advancing our understanding of psbB evolution in Populus species?

Comparative genomics approaches are providing unprecedented insights into the evolution of photosynthetic genes including psbB across Populus species. Based on recent advances in Populus genomics, several methodological frameworks are proving particularly valuable:

Whole Genome Sequencing and Assembly:
The high-quality genome assembly of Populus hybrids, such as the poplar 84K (P. alba × P. tremula var. glandulosa) with contig N50 of 1.99 Mb and scaffold N50 of 19.6 Mb , provides essential reference data for comparative analyses. These assemblies include complete chloroplast genomes where psbB is located.

Subgenome Discrimination in Hybrid Poplars:
Advanced genomic approaches have enabled researchers to distinguish between the two parental subgenomes in hybrid poplars, with approximately 356 Mb from P. alba (subgenome A) and 354 Mb from P. tremula var. glandulosa (subgenome G) . This discrimination allows for unprecedented analysis of chloroplast gene inheritance and evolution.

Methodological Approach for Comparative Analysis:

  • Sequence Conservation Analysis:

    • Align psbB sequences across multiple Populus species

    • Identify conserved domains indicative of functional constraints

    • Calculate evolutionary rates (dN/dS) across different regions

  • Promoter Evolution Analysis:

    • Compare regulatory regions of psbB across Populus species

    • Identify conserved cis-regulatory elements

    • Correlate promoter divergence with expression differences, building on observations that higher promoter divergence is associated with expression bias in hybrid systems

  • Synteny Analysis:

    • Examine conservation of gene order surrounding psbB

    • Identify potential operon-like structures preserved across species

  • Transcriptional Bias Investigation:

    • Leverage findings that hybrid poplars show transcriptional bias between subgenomes

    • Determine if chloroplast genes show similar patterns of bias

    • Apply methodologies from studies showing that in poplar 84K and P. tremula × P. alba, more than 54.4% of allelic genes showed transcriptional bias toward subgenome G

These comparative genomics approaches provide valuable insights into the evolutionary forces shaping psbB and other photosynthetic genes in Populus species, with implications for understanding adaptation to diverse environmental conditions.

What opportunities exist for enhancing photosynthetic efficiency through targeted modifications of CP47 in Populus alba?

Enhancing photosynthetic efficiency through targeted modifications of CP47 represents an ambitious frontier in Populus research. Several promising approaches exist, based on our understanding of photosynthetic machinery and advances in molecular techniques:

Strategic Approach 1: Optimizing Light-Harvesting Properties
CP47 serves as a core antenna protein that binds chlorophyll molecules and transfers excitation energy to the reaction center. Targeted modifications could:

  • Alter chlorophyll-binding sites to optimize spectral properties

  • Modify amino acids involved in energy transfer to reduce non-photochemical quenching

  • Engineer faster recovery from photoprotective states

Strategic Approach 2: Enhancing Stress Tolerance
Research on stress responses in Populus provides a foundation for improving CP47 function under adverse conditions :

  • Identify amino acid residues susceptible to oxidative damage during stress

  • Engineer more stable variants based on comparative genomics across stress-tolerant species

  • Integrate insights from stress-responsive transcription factors like PagERF021 to optimize CP47 expression under stress

Strategic Approach 3: Improving Protein-Protein Interactions
The efficiency of photosystem II depends on optimal interactions between its component proteins:

  • Fine-tune interfaces between CP47 and other PSII subunits

  • Optimize interactions with assembly factors and repair machinery

  • Enhance binding to photoprotective proteins

Methodological Considerations:

ApproachMethodsAdvantagesChallenges
Site-directed mutagenesisAgrobacterium-mediated transformation Precise modificationsLimited to single changes
Domain swappingSynthetic biology techniquesMore substantial modificationsPotential structural disruption
Directed evolutionHigh-throughput screening systemsDiscovers non-intuitive solutionsTechnical complexity in trees
CRISPR base editingAdvanced genome editingPrecise modifications without DSBsDelivery challenges in trees

Implementation Pathway:

  • Conduct bioinformatic analysis to identify promising modification targets

  • Test modifications in model systems (e.g., cyanobacteria)

  • Validate successful candidates in Populus using established transformation protocols

  • Assess photosynthetic parameters in controlled and field conditions

This research direction combines fundamental photosynthesis research with applied biotechnology, offering potential pathways to enhance productivity and stress resilience in Populus alba.

What are the key considerations for translating basic research on CP47 into practical applications for Populus alba improvement?

Translating basic research on CP47 and the psbB gene into practical applications for Populus alba improvement requires bridging fundamental photosynthesis research with tree breeding and biotechnology. Several key considerations emerge:

Scientific Foundations:

Technical Considerations:

  • Develop efficient transformation systems specific to Populus alba, building on established protocols for hybrid poplars

  • Optimize regeneration and selection methods for transformed tissues

  • Establish field trial protocols that comply with regulatory requirements for genetically modified trees

Research-to-Application Pipeline:

  • Prioritize modifications with highest potential impact on photosynthetic efficiency

  • Test promising modifications first in model systems before moving to Populus

  • Develop high-throughput phenotyping methods for assessing photosynthetic parameters

  • Integrate molecular markers associated with improved photosynthesis into breeding programs

Ecological and Sustainability Considerations:

  • Assess potential ecological impacts of modified trees

  • Evaluate performance under anticipated climate change scenarios

  • Balance photosynthetic improvements with other important traits (e.g., wood quality, stress tolerance)

Collaborative Framework:

  • Establish interdisciplinary teams combining expertise in:

    • Photosynthesis biochemistry

    • Tree genomics and breeding

    • Biotechnology

    • Ecology and environmental science

  • Develop public-private partnerships to facilitate translation to applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.