Recombinant Populus alba Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Recombinant Production

This protein is synthesized using heterologous expression systems for high purity and reproducibility:

ParameterSpecification
Expression SystemE. coli, yeast, baculovirus, or mammalian cells
TagHis-tag (varies by vendor; some products are tag-free)
Purity≥85% (SDS-PAGE verified)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose or 50% glycerol

Applications in Research

Recombinant Populus alba PsbA is widely used for:

  • ELISA Development: Quantifying D1 protein levels in photosynthetic organisms .

  • Antibody Validation: Detecting PsbA degradation products (e.g., 24 kDa N-terminal or 10 kDa C-terminal fragments) .

  • Herbicide Studies: Analyzing interactions with triazine and urea-based herbicides .

  • Quantitative Western Blotting: Paired with global anti-PsbA antibodies, enabling precise PSII quantification (e.g., 0.05–0.45 pmole detection range) .

Research Findings

  • Degradation Dynamics: PsbA undergoes rapid turnover under high light, producing 24 kDa and 16 kDa fragments detectable with C-terminal antibodies .

  • Cross-Linking: D1 forms complexes with cytochrome b559 and D2 protein, altering migration on SDS-PAGE .

  • Quantitative Standards: Recombinant PsbA from Synechocystis PCC 6803 (homologous to Populus alba) enables absolute quantification in diverse species, with linear detection between 0.05–0.45 pmoles .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Populus alba (White poplar)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H(2)O, generating O(2) and a proton gradient that is subsequently used for ATP formation. It comprises a core antenna complex responsible for capturing photons, and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein and what role does it play in photosynthesis?

The Photosystem Q(B) protein, encoded by the psbA gene, is an essential component of Photosystem II that facilitates oxygenic photosynthetic electron transport. This 32 kDa thylakoid membrane protein (also called Photosystem II protein D1) contains binding sites for electron acceptors and is crucial for the water-splitting reactions in photosynthesis. The protein functions as an electron transfer component between the primary electron acceptor QA and the secondary quinone acceptor QB in the electron transport chain. The protein is notably the target for several herbicides which act by binding directly to the photosynthetic apparatus, disrupting electron flow . In Populus alba, this protein contains 344 amino acids and plays a fundamental role in the plant's ability to convert light energy into chemical energy.

How does the psbA gene in Populus alba differ from psbA genes in other photosynthetic organisms?

While cyanobacteria like Anacystis nidulans R2 contain multiple copies of the psbA gene (three distinct psbA genes encoding the QB protein), Populus alba contains a single psbA gene . The amino acid sequence of the psbA gene product in P. alba shows considerable conservation with other plant species but includes species-specific variations that may confer unique functional properties. These differences are particularly relevant when studying herbicide resistance, as slight variations in the QB protein structure can significantly affect herbicide binding affinity. Unlike some cyanobacteria where different psbA genes can compensate for each other when inactivated (as shown in Anacystis nidulans), the single psbA gene in P. alba represents a critical component that cannot be functionally replaced by other genes .

What are the optimal storage conditions for recombinant Populus alba psbA protein?

Recombinant Populus alba Photosystem Q(B) protein should be stored at -20°C for regular use, but for extended storage, conservation at -20°C or -80°C is recommended . The protein is typically supplied in a Tris-based buffer containing 50% glycerol that has been optimized specifically for this protein to maintain its stability and activity. It is important to note that repeated freezing and thawing is not recommended as this can lead to protein denaturation and loss of activity. For ongoing experiments, researchers should prepare working aliquots that can be stored at 4°C for up to one week . This approach minimizes freeze-thaw cycles while ensuring that fresh, active protein is available for experiments throughout the week. When handling the protein, it's advisable to keep it on ice and minimize exposure to room temperature.

How can researchers effectively express recombinant Populus alba psbA protein in heterologous systems?

Expressing recombinant Populus alba psbA protein in heterologous systems requires careful consideration of the expression vector, host organism, and induction conditions. Based on current research practices, the following methodological approach is recommended:

  • Vector selection: Choose expression vectors with strong, inducible promoters compatible with the host system. For plant membrane proteins like psbA, vectors containing T7 or similar strong promoters often yield good results.

  • Host selection: E. coli strains such as BL21(DE3) or Rosetta are commonly used, but for membrane proteins like psbA, specialized strains designed for membrane protein expression may provide better yields.

  • Codon optimization: The psbA gene sequence should be codon-optimized for the expression host to improve translation efficiency, particularly given that plant codon usage differs significantly from bacterial hosts.

  • Expression conditions: Lower temperature induction (16-20°C) often improves the solubility and proper folding of membrane proteins. IPTG concentrations of 0.1-0.5 mM typically provide sufficient induction while minimizing protein aggregation.

  • Extraction protocols: Since psbA is a membrane protein, specialized extraction protocols using detergents such as n-dodecyl β-D-maltoside (DDM) or digitonin are necessary to maintain protein structure.

The use of fusion tags can facilitate both expression and purification, though care must be taken as these may affect protein function. The tag type for commercially available recombinant Populus alba psbA protein is typically determined during the production process to optimize for both yield and activity .

What methods can be used to verify the functional activity of recombinant psbA protein?

Verifying the functional activity of recombinant Populus alba psbA protein requires assessing its electron transport capabilities and herbicide binding characteristics. Several methodological approaches are recommended:

  • Electron transport assays: Measure the rate of electron transfer from water to artificial electron acceptors such as dichlorophenolindophenol (DCPIP) or ferricyanide. This can be monitored spectrophotometrically by following the reduction of these acceptors.

  • Herbicide binding assays: Since psbA is the target of several herbicides, competitive binding assays using radiolabeled herbicides (such as 14C-atrazine) can confirm proper protein folding and function.

  • Reconstitution experiments: The recombinant protein can be reconstituted into liposomes or nanodiscs to create a minimal functional unit, allowing for more controlled activity measurements.

  • Circular dichroism (CD) spectroscopy: This technique can verify that the recombinant protein maintains the appropriate secondary structure, which is critical for its function.

  • Thermal stability assays: Differential scanning fluorimetry can assess the protein's thermal stability, which often correlates with proper folding and functional state.

When conducting these assays, it is essential to include both positive controls (such as native thylakoid preparations) and negative controls (heat-denatured protein) to validate the results and ensure that the observed activities are specific to the properly folded recombinant psbA protein .

How can recombinant psbA be used to study herbicide resistance mechanisms in Populus alba?

Recombinant Populus alba psbA protein provides a valuable tool for investigating herbicide resistance mechanisms through several advanced approaches:

  • Site-directed mutagenesis studies: By introducing specific mutations in the psbA gene before recombinant expression, researchers can systematically evaluate how amino acid changes affect herbicide binding. This approach allows for the identification of key residues involved in herbicide resistance. The QB protein is a known target for several herbicides that act by binding directly to the photosynthetic apparatus . Mutations in the protein can potentially confer resistance to these herbicides.

  • Comparative binding assays: Researchers can conduct in vitro binding assays with various herbicides using both wild-type and mutant recombinant psbA proteins to quantify differences in binding affinity and kinetics. These assays typically employ either fluorescence quenching or isothermal titration calorimetry techniques.

  • Structural biology approaches: X-ray crystallography or cryo-electron microscopy of the recombinant protein in complex with different herbicides can provide atomic-level insights into the binding mechanisms and how specific mutations disrupt these interactions.

  • In vivo validation: Transgenic poplar lines expressing modified psbA variants can be generated to validate in vitro findings and assess whole-plant herbicide resistance. The high transformation efficiency of Populus alba makes it an excellent system for such validation studies .

  • Molecular dynamics simulations: Computational approaches using the recombinant protein's structure can predict how mutations might affect herbicide binding, guiding experimental design and helping interpret results.

This multilayered approach leverages the availability of recombinant psbA to bridge in vitro mechanistic studies with in vivo validation, offering comprehensive insights into herbicide resistance mechanisms in woody plant species.

What role does psbA play in CRISPR/Cas genome editing experiments in Populus alba?

The psbA gene serves as both a potential target and a model system for CRISPR/Cas genome editing in Populus alba research due to several important factors:

  • Target selection and gRNA design: The availability of genomic sequence data for Populus alba, including the psbA gene region, has enabled researchers to design effective guide RNAs (gRNAs) for CRISPR/Cas experiments. The genomic resources derived from whole-genome assembly projects have been applied for screening 717 gRNAs for sequence variants to optimize gRNA design in CRISPR/Cas genome editing experiments .

  • Phenotypic screening: Modifications to the psbA gene create readily observable phenotypes related to photosynthetic efficiency or herbicide resistance, making it an excellent reporter system for assessing editing efficiency. Researchers can apply herbicides as a selection agent to identify successfully edited plants.

  • Homology-directed repair templates: Recombinant psbA protein studies have provided detailed sequence and functional information that guides the design of repair templates for precise gene editing, allowing for specific amino acid substitutions that confer desired traits.

  • Transformation protocols optimization: The well-established transformation protocols for Populus alba, which has demonstrated high transformation efficiency and short transformation time , can be leveraged for delivering CRISPR/Cas components targeting the psbA gene.

  • Multiplexed editing strategies: Knowledge of the psbA gene's interaction with other photosynthetic components allows researchers to design multiplexed CRISPR experiments targeting several genes simultaneously to study pathway-level modifications.

The combination of available genomic resources, efficient transformation protocols, and clear phenotypic readouts makes the psbA gene system particularly valuable for advancing CRISPR/Cas applications in forest tree species research and biotechnology.

How can comparing psbA sequences across different Populus species inform evolutionary studies?

Comparative analysis of psbA sequences across different Populus species provides valuable insights into evolutionary processes through several methodological approaches:

  • Phylogenetic analysis: Alignment of psbA sequences from Populus alba, P. trichocarpa, P. tremula, and other Populus species enables construction of phylogenetic trees that reflect evolutionary relationships. These analyses can reveal whether psbA evolution mirrors whole-genome phylogeny or shows distinct patterns of selection.

  • Selection pressure analysis: Calculating the ratio of non-synonymous to synonymous substitutions (dN/dS) across different regions of the psbA gene helps identify domains under positive, neutral, or purifying selection. This approach can reveal how environmental pressures have shaped the evolution of photosynthetic function across Populus species.

  • Structural comparison: Mapping sequence variations onto the three-dimensional structure of the psbA protein identifies whether changes occur predominantly in functional domains or surface-exposed regions, providing insights into structure-function relationships across evolutionary time.

  • Ecological correlation studies: Correlating psbA sequence variations with the ecological niches of different Populus species can identify adaptations to specific environmental conditions such as light intensity, temperature ranges, or drought stress.

  • Interspecific hybridization analysis: Examining psbA sequences in natural hybrids like Populus tremula x P. alba (P. x canescens) can reveal patterns of introgression and potential adaptive advantages conferred by particular alleles.

Genome sequence resources for Populus species, such as P. trichocarpa and P. alba, provide the necessary comparative data for these analyses . The availability of whole-genome sequences reveals that while many genes have orthologs between species, there are also species-specific expansions and contractions of gene families that reflect evolutionary adaptations .

What are common challenges in isolating native psbA protein from Populus alba tissues?

Isolating native psbA protein from Populus alba tissues presents several challenges that researchers should anticipate and address:

  • Membrane protein solubilization: As an integral membrane protein, psbA is embedded in the thylakoid membrane, requiring careful selection of detergents for solubilization. Commonly, n-dodecyl β-D-maltoside (DDM), digitonin, or Triton X-100 are used, but optimization of detergent type and concentration is often necessary for Populus alba tissues specifically.

  • Proteolytic degradation: The D1 protein (psbA) has a naturally high turnover rate in vivo, making it susceptible to degradation during isolation. Adding multiple protease inhibitors (e.g., PMSF, leupeptin, and pepstatin A) to all buffers is essential, and maintaining cold temperatures (0-4°C) throughout the isolation process helps minimize degradation.

  • Co-purification of contaminants: The psbA protein forms complex associations with other photosystem components, leading to co-purification of unwanted proteins. Sequential purification steps, potentially including ion exchange chromatography followed by size exclusion, may be necessary to achieve high purity.

  • Maintenance of functional state: Isolated psbA easily loses its functional activity during purification. Adding stabilizing agents such as glycerol (20-30%) and specific lipids that mimic the native membrane environment can help maintain protein activity.

  • Low abundance in woody tissues: Unlike herbaceous plants, the woody nature of Populus alba tissues presents additional extraction challenges. Starting with young leaves rather than stem tissues can increase yield, as can harvesting tissues early in the day when photosynthetic protein expression is typically higher.

  • Seasonal variation: The expression level of psbA varies seasonally in perennial woody plants like Populus alba. Standardizing the collection time and growth conditions can help ensure consistency in protein yield and quality across experiments.

Using recombinant protein expression systems circumvents many of these challenges, explaining why recombinant Populus alba psbA protein has become a valuable research tool .

How can researchers distinguish between different isoforms or variants of psbA in experimental samples?

Distinguishing between different isoforms or variants of psbA in experimental samples requires a combination of molecular and analytical techniques:

  • Isoform-specific PCR: Design primers that target unique regions of different psbA variants for PCR amplification. This approach is particularly useful for detecting known variants at the DNA or RNA level before protein isolation. Unlike cyanobacteria which contain multiple psbA genes (as seen in Anacystis nidulans R2 with three distinct psbA genes) , Populus alba contains a single psbA gene, but polymorphisms or RNA editing may create variants.

  • Mass spectrometry (MS):

    • Peptide mass fingerprinting: Digest the protein with specific proteases and analyze the resulting peptide fragments by MALDI-TOF MS to generate a mass fingerprint that can distinguish between variants.

    • Tandem MS (MS/MS): This provides sequence information for specific peptides, allowing identification of amino acid substitutions that differentiate variants.

  • 2D electrophoresis: Separate proteins based on both isoelectric point and molecular weight, which can resolve isoforms that differ in charge or size due to post-translational modifications or sequence variations.

  • Isoform-specific antibodies: Develop antibodies that specifically recognize unique epitopes in different psbA variants for use in Western blotting or immunoprecipitation experiments.

  • High-resolution chromatography: Techniques such as reverse-phase HPLC can separate psbA variants based on subtle differences in hydrophobicity resulting from amino acid substitutions.

  • Post-translational modification analysis: Phosphorylation, acetylation, or other modifications can create functional variants of psbA. Specific staining methods or antibodies against these modifications can identify such variants.

When applying these techniques to Populus alba samples, researchers should be aware that while the genome contains a single psbA gene, RNA editing and post-translational modifications may generate functional diversity at the protein level.

What are the critical considerations when designing primers for psbA amplification from Populus alba?

Designing effective primers for psbA amplification from Populus alba requires attention to several critical factors:

  • Sequence specificity: Utilize the available genomic resources for Populus alba to ensure primers are specific to the psbA gene and will not amplify other genes or pseudogenes. BLAST analysis against the complete Populus alba genome should be performed to verify specificity.

  • Conservation vs. variability: Design primers in highly conserved regions of the psbA gene to ensure robust amplification, but position them to flank regions of interest that may contain variations. The Populus alba psbA gene shows high conservation in some regions while exhibiting variability in others, particularly compared to related species.

  • Consideration of introns: Although the psbA gene is typically intronless in many plants, verify this in Populus alba specifically. The genomic sequence data available from whole-genome assemblies of Populus species can confirm the gene structure .

  • GC content optimization: Aim for primers with 40-60% GC content and ensure the 3' end contains one or two G/C bases for stronger annealing without creating opportunities for primer-dimer formation.

  • Primer length and Tm matching: Design primers between 18-25 nucleotides in length with similar melting temperatures (preferably within 2-3°C of each other) to allow efficient annealing during PCR cycling.

  • Secondary structure avoidance: Use primer design software to check for potential secondary structures, hairpins, or self-complementarity that could reduce primer efficiency.

  • Consideration for downstream applications: If the PCR product will be used for cloning, include appropriate restriction sites flanked by 3-4 extra bases at the 5' ends to facilitate efficient enzyme digestion.

  • Taxonomic applicability: If comparative studies across Populus species are planned, design primers in regions conserved across species based on multiple sequence alignments of psbA from P. alba, P. trichocarpa, and other relevant species.

Using these guidelines ensures robust and specific amplification of the psbA gene from Populus alba for various downstream applications including sequencing, cloning, or expression studies.

How is psbA being used in genetic transformation studies of Populus alba?

The psbA gene serves as an important component in genetic transformation studies of Populus alba through several research approaches:

  • Reporter gene systems: The psbA promoter is being used to drive expression of reporter genes in transformation experiments, allowing researchers to monitor transformation efficiency and gene expression patterns in different tissues and developmental stages. The high transformation efficiency of Populus alba makes it an excellent model system for such studies .

  • Herbicide resistance markers: Modified versions of the psbA gene conferring herbicide resistance are being developed as selection markers for transformation experiments, providing alternatives to traditional antibiotic resistance genes. This approach leverages the natural role of psbA as a target for herbicides that bind directly to the photosynthetic apparatus .

  • Chloroplast transformation: The psbA gene and its flanking regions are being utilized as homologous recombination targets for chloroplast transformation in Populus alba, enabling precise manipulation of the chloroplast genome for studies of photosynthetic efficiency and plastid gene expression.

  • CRISPR/Cas editing targets: The psbA gene serves as a target for CRISPR/Cas genome editing in Populus alba, with researchers using whole-genome sequence data to design effective guide RNAs. The genomic resources derived from Populus species have been applied for screening gRNAs for sequence variants to optimize gRNA design in CRISPR/Cas genome editing experiments .

  • Transgene integration studies: The soil persistence of DNA from transgenic poplars, including those with modified photosynthetic genes, is being investigated to understand the environmental implications of genetically modified trees. Studies have shown that recombinant DNA can be detected in soil cultivated with transgenic white poplars over extended periods (up to 20 months) .

These research directions are facilitated by the availability of recombinant psbA protein for structure-function studies and the high genetic transformation efficiency of Populus alba, which has been confirmed experimentally .

What insights has comparative genomics provided about psbA function in Populus species?

Comparative genomics analyses across Populus species have yielded several important insights about psbA function and evolution:

The whole-genome draft assembly of Populus tremula x P. alba and the de novo genome sequence of P. alba var. pyramidalis provide valuable resources for these comparative approaches . These genomic resources supplement existing sequence data and provide access to sequences that show low similarity to the P. trichocarpa reference genome, enabling more comprehensive comparative analyses.

How does the structure and function of psbA in Populus alba compare to that in cyanobacteria and other photosynthetic organisms?

Comparing the structure and function of psbA between Populus alba and other photosynthetic organisms reveals important evolutionary adaptations and functional conservation:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.