Recombinant Populus deltoides Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Production

CP47, encoded by the psbB gene, serves as a chlorophyll-binding antenna protein in PSII. The recombinant version from Populus deltoides (Eastern cottonwood) is produced using baculovirus expression systems . Key specifications include:

ParameterDetail
UniProt IDO03061
Protein LengthPartial sequence (exact residues unspecified)
Purity>85% (SDS-PAGE)
TagUndisclosed (determined during manufacturing)
StorageLyophilized powder at -20°C/-80°C; reconstituted in glycerol
SourceBaculovirus

The protein retains functional chlorophyll-binding domains, enabling studies on light harvesting and energy transfer .

Amino Acid Sequence

The CP47 apoprotein contains conserved histidine residues critical for chlorophyll ligation. Structural homology modeling reveals six transmembrane helices, with five chlorophyll molecules directly coordinated by histidine residues in Populus species . This configuration aligns with CP47’s role in stabilizing PSII’s reaction center .

Gene Organization

In Populus deltoides, the psbB gene resides in a polycistronic operon alongside psbT, psbH, petB, and petD. Post-transcriptional processing generates mono- and oligo-cistronic RNAs, reflecting evolutionary conservation with crop plants but featuring unique RNA maturation patterns .

Photosystem Assembly Studies

CP47 interacts with assembly factors like Psb27, a lipoprotein essential for PSII maturation. Mass spectrometry of Psb27-PSII complexes from thermophilic cyanobacteria identified six lipid-modified Psb27 proteoforms, suggesting regulatory roles in CP47 integration during PSII assembly .

Nitrogen Metabolism

CP47 homologs in poplar bark (e.g., bark storage protein BSP) sequester nitrogen during dormancy. Recombinant CP47 tools enable investigations into nitrogen cycling and storage mechanisms in perennial plants .

Comparative Analysis with Orthologs

Recombinant CP47 proteins from related species highlight functional conservation:

SpeciesPopulus deltoides Oenothera glazioviana Populus alba
Expression HostBaculovirusE. coliE. coli
TagUndisclosedHis-tagHis-tag
Full-Length SequencePartialFull (1-508 aa)Full (1-508 aa)
Key ResiduesConserved His for chlorophyllConserved His for chlorophyllConserved His for chlorophyll

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade the protein, necessitating aliquoted storage .

  • Structural Resolution: Current models rely on low-resolution (8 Å) density maps; advanced cryo-EM could refine chlorophyll positioning .

  • Biotechnological Potential: Engineered CP47 variants may enhance photosynthetic efficiency in crops .

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we understand that specific requirements may arise. Please indicate your preferred format in the order notes, and we will make every effort to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: Our proteins are standardly shipped with regular blue ice packs. If dry ice shipping is required, please inform us in advance to accommodate the necessary arrangements and associated fees.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a particular tag type in mind, please inform us, and we will prioritize developing it for your order.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-509
Protein Length
full length protein
Species
Populus deltoides (Eastern poplar) (Eastern cottonwood)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVELNDPGRLLAVHMMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITKSWGGWSITGGTITNPGIWSYEGVAGSHIVFSGLCFLAAIWHWVYWDL EIFCDDRTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGTGLAENQSLS EAWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAIGWLGHPLIRDKEGRDVFVRRI PTFFETFRVVLDDDDGMVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKK YARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGSRTLFRDVF AGIDPDLDAQVEFGAFQKLGDPTTRRQVV
Uniprot No.

Target Background

Function
Photosystem II CP47 chlorophyll apoprotein (psbB) is a crucial component of the core complex in photosystem II (PSII). It binds chlorophyll and plays a vital role in catalyzing the primary light-induced photochemical processes of PSII. PSII, a light-driven water:plastoquinone oxidoreductase, utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient that subsequently drives ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is PsbB protein and what is its functional role in Photosystem II?

PsbB, also known as CP47, is an intrinsic transmembrane protein located in the reaction center of Photosystem II (PSII). It functions as a core antenna protein that binds to chlorophyll a and β-Carotene molecules, facilitating the capture of light energy and its transfer to the reaction center . The protein has a molecular weight of approximately 56 kDa and plays a crucial role in the initial stages of photosynthesis.

CP47 works in concert with CP43 (PsbC) as the primary light-harvesting proteins within PSII. Biochemical and structural studies have demonstrated that CP47 has a close association with both the photochemical reaction center and the extrinsic oxygen evolution enhancer proteins . This positioning is critical for efficient energy transfer within the photosystem. Within the larger photosynthetic electron transport chain, PSII facilitates electron transport that drives proton pumping for ATP generation, making CP47 essential for the plant's energy production system .

How is the psbB gene organized in the chloroplast genome of Populus deltoides?

In Populus deltoides, the psbB gene is part of a polycistronic transcription unit known as the psbB operon. This operon contains genes encoding components of both the PSII complex (psbB, psbT, psbH) and the cytochrome b6f complex (petB, petD) . This is a particularly interesting feature of chloroplast gene organization, as it places genes for two different protein complexes that are needed in varying quantities during chloroplast biogenesis within the same transcriptional unit.

While the general organization of this operon in P. deltoides resembles that found in other plant species, nucleotide sequencing has revealed some variations specific to this tree species in the post-transcriptional processing scheme . These variations may reflect adaptations related to the perennial lifestyle of trees compared to annual crop plants that have been more extensively studied.

What methods are available for detecting and quantifying PsbB protein in research samples?

Immunological detection using antibodies remains one of the most effective approaches for PsbB protein analysis. Polyclonal antibodies developed against conserved regions of the protein show cross-reactivity across multiple plant species, including trees like Populus . These antibodies can be utilized in various applications including:

  • Western blot analysis (recommended dilution 1:2000) for protein detection and semi-quantitative analysis

  • Clear-native PAGE (CN-PAGE) (recommended dilution 1:10,000) for studying native protein complexes

  • Immunolocalization studies to determine subcellular distribution of the protein

For more quantitative analysis, researchers can employ spectroscopic methods that leverage the chlorophyll-binding properties of CP47. Additionally, mass spectrometry approaches can be used for precise quantification and post-translational modification analysis of recombinant PsbB protein.

What are effective strategies for cloning and expressing recombinant psbB from Populus deltoides?

Cloning and expressing the psbB gene from Populus deltoides requires consideration of several factors:

What techniques are most reliable for analyzing PsbB protein-protein interactions within Photosystem II?

Several complementary approaches can be employed to study protein-protein interactions involving PsbB:

  • Co-immunoprecipitation: Using antibodies against PsbB (CP47) to pull down the protein along with its interaction partners, followed by mass spectrometry identification. This approach works well for stable interactions.

  • Clear-native PAGE: This technique preserves protein-protein interactions while separating complexes based on size and charge, making it particularly valuable for studying membrane protein complexes like PSII .

  • Crosslinking mass spectrometry: Chemical crosslinking followed by mass spectrometry analysis can capture both stable and transient interactions, providing insight into the dynamic assembly of PSII complexes.

  • Förster resonance energy transfer (FRET): When studying recombinant proteins, fluorescent tags can be strategically placed to monitor protein-protein interactions in real-time, though care must be taken to ensure tags don't disrupt normal protein function.

  • Structural biology approaches: X-ray crystallography and cryo-electron microscopy have provided critical insights into PSII structure, including the positioning of CP47 relative to other components .

How can researchers address contradictory results when studying PsbB function and interactions?

Contradictory results are common in complex biological systems and have been shown to be highly prevalent in protein-protein interaction networks . When facing contradictions in PsbB research, consider the following methodological approaches:

  • Context identification: Most apparent contradictions stem from different experimental contexts. Carefully document and consider variables such as:

    • Developmental stage of plant material

    • Growth conditions (light intensity, nutrient availability)

    • Tissue type

    • Genetic background/ecotype of P. deltoides used

  • Controlled comparative studies: Design experiments that directly test contradictory findings under identical conditions to determine whether differences are reproducible.

  • Integration of multiple techniques: Combine complementary methodologies (e.g., both biochemical and biophysical approaches) to provide converging evidence.

  • Consideration of post-translational modifications: Modifications can dramatically alter protein function and may explain seemingly contradictory observations about PsbB behavior.

  • Qualification of results: Rosemblat et al. found that apparent contradictions in literature-derived knowledge graphs often need qualification by information such as population group, species, or experimental conditions . Carefully qualifying all research findings with such contextual details can help resolve apparent contradictions.

How does PsbB structure and function in Populus deltoides compare to that in other plant species?

While the core function of PsbB as a chlorophyll-binding component of PSII's reaction center is conserved across photosynthetic organisms, several comparative aspects are worth noting:

What unique post-transcriptional processing events occur in the psbB operon of Populus deltoides?

The psbB operon in chloroplasts undergoes complex post-transcriptional processing to generate a variety of mono- and oligo-cistronic RNAs from the initial polycistronic transcript. In P. deltoides, this operon contains genes for both PSII (psbB, psbT, psbH) and cytochrome b6f (petB, petD) complexes .

Nucleotide sequencing and RNA profiling of P. deltoides has revealed that while the gene organization resembles that of other species, there are notable variations in the processing scheme . These variations may include:

  • Different splicing patterns for the intron-containing genes (petB and petD)

  • Alternative cleavage sites that generate distinct RNA species

  • Species-specific RNA stabilization mechanisms

These processing differences likely influence the relative abundance of the different proteins encoded by the operon, potentially optimizing the stoichiometry of photosynthetic components for the specific ecological niche occupied by P. deltoides as a riparian tree species.

How does genetic diversity impact PsbB expression and function across different P. deltoides populations?

Populus deltoides resources exhibit high genetic diversity with moderate genetic differentiation among provenances . This diversity likely impacts PsbB expression and function in several ways:

  • Regulatory variation: Different populations may show altered expression patterns of the psbB gene in response to environmental cues, reflecting local adaptation.

  • Protein sequence polymorphisms: While core functional regions are likely conserved, population-level variations in less constrained regions of the protein may exist, potentially affecting interactions with other components or regulatory factors.

  • Processing efficiency: Variations in intergenic regions may affect the efficiency of post-transcriptional processing, leading to population-specific differences in the relative abundance of different proteins encoded by the psbB operon.

  • Environmental response: Different P. deltoides populations may show distinct patterns of PsbB regulation in response to stressors such as drought, temperature extremes, or pathogen exposure, reflecting adaptation to local conditions.

This genetic diversity presents both challenges and opportunities for researchers, necessitating careful documentation of plant material origins and consideration of population effects when interpreting experimental results.

What are the cutting-edge approaches for studying the assembly dynamics of PsbB into functional PSII complexes?

Several advanced techniques are revolutionizing our understanding of PSII assembly dynamics:

  • Time-resolved cryo-electron microscopy: This approach allows visualization of assembly intermediates, providing insight into the stepwise incorporation of CP47 into the growing PSII complex.

  • Single-molecule tracking: By tagging PsbB with photoactivatable fluorescent proteins, researchers can track the movement and incorporation of individual proteins within the thylakoid membrane.

  • Pulse-chase experiments with stable isotope labeling: This approach allows researchers to track newly synthesized CP47 as it is incorporated into PSII complexes, revealing the temporal dynamics of assembly.

  • In vitro reconstitution systems: These systems enable controlled assembly of PSII components, allowing detailed investigation of the requirements and kinetics of CP47 incorporation.

  • Genetic approaches with inducible expression: By controlling the timing of CP47, researchers can observe the consequences for PSII assembly, revealing the coordination between protein synthesis and complex formation.

How can site-directed mutagenesis of recombinant psbB help elucidate structure-function relationships?

Site-directed mutagenesis of recombinant psbB provides powerful insights into CP47 function:

  • Chlorophyll-binding site analysis: Mutations in predicted chlorophyll-binding residues can confirm their roles and assess their contributions to energy transfer efficiency.

  • Interface mapping: Mutations at interfaces with other PSII components can reveal critical interaction surfaces and residues essential for complex stability.

  • Channel functionality: CP47 may participate in forming channels for water or proton movement; strategic mutations can test hypothesized channel residues.

  • Species-specific variations: Introducing P. deltoides-specific residues into better-characterized systems (or vice versa) can reveal the functional significance of species-specific adaptations.

  • Post-translational modification sites: Mutating residues subject to modification can reveal their regulatory significance.

This approach is particularly powerful when combined with functional assays (oxygen evolution, chlorophyll fluorescence) and structural studies to connect specific residues to both local and global effects on protein function.

What implications does climate change research have for understanding PsbB function in Populus deltoides populations?

Climate change presents both challenges and research opportunities related to PsbB function in P. deltoides:

  • Temperature sensitivity: Increasing temperatures may affect the stability and function of PSII complexes, with potential population-specific responses based on local adaptation.

  • Drought response mechanisms: Water limitation affects photosynthetic efficiency, potentially through mechanisms involving PSII components like CP47.

  • Elevated CO2 effects: Changing atmospheric CO2 concentrations may alter the stoichiometry of photosynthetic components, including those encoded by the psbB operon.

  • Population resilience assessment: The high genetic diversity in P. deltoides may harbor adaptive variants with enhanced tolerance to changing conditions. Screening for PsbB sequence and expression variations across populations experiencing different climate regimes could identify potentially adaptive features.

  • Range shift implications: As suitable habitats shift with changing climate, understanding how PsbB variants contribute to photosynthetic efficiency under novel conditions becomes increasingly important.

Research in this area can contribute both to fundamental understanding of photosynthetic adaptation and to applied efforts in forest management and conservation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.