Recombinant Populus deltoides Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs unless otherwise requested. For dry ice shipping, please contact us in advance as additional fees apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, briefly centrifuge the vial to ensure all contents settle to the bottom. Reconstitute the protein using deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing it accordingly.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Populus deltoides (Eastern poplar) (Eastern cottonwood)
Target Names
psbA
Target Protein Sequence
TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein in Populus deltoides and what is its primary function?

The Photosystem Q(B) protein, also known as Photosystem II protein D1 or 32 kDa thylakoid membrane protein, is encoded by the psbA gene in Populus deltoides. This protein functions as a critical component of Photosystem II with the enzyme classification number EC 1.10.3.9. The full-length protein consists of 343 amino acids (expression region 2-344) and serves as the binding site for the secondary quinone electron acceptor in PSII .

Methodologically, researchers investigate this protein's function through electron transport measurements, observing how it accepts electrons from the primary quinone acceptor (QA) and undergoes sequential reduction and protonation to form Q(B)H2. This process is fundamental to the light-dependent reactions of photosynthesis, enabling the conversion of light energy to chemical energy through electron transport.

How does the Photosystem Q(B) protein interact with other components of the photosynthetic electron transport chain?

The Photosystem Q(B) protein functions within a complex electron transport system where it works in series with the QA cofactor. While QA serves as a one-electron carrier, Q(B) undergoes sequential reduction and protonation to form Q(B)H2. This fully reduced and protonated form exchanges with plastoquinone (PQ) from the membrane pool, continuing the electron transport chain .

Experimental investigations using quantum mechanical/molecular mechanical approaches have revealed specific proton transfer pathways essential for Q(B) function. The initial proton transfer to Q(B)- - occurs from protonated D1-His252 via D1-Ser264, while the second proton transfer likely proceeds from D1-His215 to Q(B)H- through hydrogen bonding, resulting in Q(B)H2 formation and D1-His215 anion production . Understanding these intricate interactions requires sophisticated biophysical techniques including site-directed mutagenesis and electron transport measurements.

What is the complete amino acid sequence of Populus deltoides Photosystem Q(B) protein?

The complete amino acid sequence of the Populus deltoides Photosystem Q(B) protein is:

TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

For researchers working with this protein, it's important to note that it is a membrane-bound protein with multiple transmembrane domains, and proper expression and folding are crucial for maintaining its structural integrity and function when producing recombinant versions.

What are the optimal storage and handling conditions for recombinant Populus deltoides Photosystem Q(B) protein?

Recombinant Populus deltoides Photosystem Q(B) protein requires specific storage and handling conditions to maintain its structural integrity and functional properties. The recommended storage buffer consists of a Tris-based buffer with 50% glycerol, optimized specifically for this protein .

For storage, it is advised to keep the protein at -20°C for regular use, while extended storage should be at either -20°C or -80°C. To preserve protein activity, researchers should avoid repeated freezing and thawing cycles. Working aliquots can be stored at 4°C but should be used within one week . These storage recommendations reflect the general challenges of maintaining membrane protein stability while preserving functional characteristics essential for experimental applications.

What techniques are most effective for studying protein-protein interactions involving the Photosystem Q(B) protein?

Studying protein-protein interactions involving Photosystem Q(B) requires specialized techniques due to its membrane-embedded nature. One effective approach involves mild solubilization of purified thylakoid membranes (using 0.5% digitonin/0.5% α-DM) followed by Blue Native PAGE (BN-PAGE) separation of protein complexes. This technique allows for the identification of native interactions between photosynthetic complexes while preserving physiologically relevant associations .

Immunoblot analysis using antibodies against specific components (such as D1 and PsaD) can identify PSII and PSI complexes, enabling researchers to track the Photosystem Q(B) protein's associations. This methodology has successfully identified several PSII forms, including supercomplexes (SC), core dimers, core monomers, and RC47 (PSII Reaction Center with CP47 but without CP43) . For more specific interactions, co-immunoprecipitation followed by mass spectrometry can provide detailed information about protein interaction partners and potential regulatory mechanisms.

How can RT-qPCR be optimized for studying gene expression of photosystem-related genes in Populus deltoides?

Optimizing RT-qPCR for studying photosystem-related gene expression in Populus deltoides requires careful attention to several methodological details. Begin with high-quality RNA isolation and DNase I treatment to eliminate genomic DNA contamination. For cDNA synthesis, 1 μg of treated RNA should be reverse-transcribed using a reliable system such as SuperScript IV VILO Master Mix .

Primer design is crucial - primers should be designed at non-conserved regions based on sequence alignment within each transcript and its homologous transcripts. Each primer pair should ideally span at least one intron or be located at exon-exon junctions to ensure amplification from cDNA templates only . For quantification, a reference gene with stable expression across experimental conditions, such as Ubiquitin (UBQ; Potri.011G134200.1), should be used for normalization .

RT-qPCR conditions should include an initial heating at 95°C for 2 min, followed by denaturation at 95°C for 5 sec and annealing/extension at 60°C for 25 sec for a total of 40 cycles. A dissociation curve analysis should always be included to validate specific amplification and check for primer-dimer formation. Data analysis using the comparative Ct (2-ΔΔCt) method provides reliable quantification of expression differences .

How do proton transfer mechanisms affect Q(B) reduction in Photosystem II, and how can they be experimentally investigated?

Proton transfer mechanisms are critical for Q(B) reduction in Photosystem II, involving a sequential process of electron and proton transfers. Experimental investigation of these mechanisms requires sophisticated quantum mechanical/molecular mechanical (QM/MM) approaches to analyze proton transfer (PT) energetics based on atomic coordinates from Photosystem II crystal structures .

The potential-energy profile reveals that initial proton transfer to Q(B)- - occurs from protonated D1-His252 via D1-Ser264, while the second proton transfer likely proceeds from D1-His215 to Q(B)H- through an H-bond with a single-well energy profile, resulting in Q(B)H2 formation and D1-His215 anion production . Researchers can experimentally investigate these pathways through site-directed mutagenesis of key residues along the proton transfer pathway, followed by functional assays to measure electron transport rates and proton uptake.

The influence of bicarbonate/formate on these mechanisms provides additional experimental approaches. Interestingly, formate ligation to Fe2+ does not significantly affect reduced Q(B) protonation, suggesting that formate inhibits Q(B)H2 release rather than its formation . This distinction highlights the importance of designing experiments that can differentiate between effects on formation versus release of reaction products.

What approaches are effective for engineering modified electron transfer pathways in Photosystem II?

Engineering modified electron transfer pathways in Photosystem II can be achieved through strategic modifications of the Q(A) binding site. Research has demonstrated that shortening the distance between Q(A) and exogenous quinones increases the reduction rate of these quinones, creating alternative electron donation pathways .

Methodologically, this involves structural prediction studies combined with screening of site-directed PSII mutants. For example, truncating the C-terminus of the PsbT subunit that protrudes into the stroma has been shown to provide a shorter distance between Q(A) and exogenous electron acceptors like 2,6-dimethyl-p-benzoquinone (DMBQ), leading to sustained electron transfer that bypasses the natural Q(A)- - to Q(B) pathway .

Researchers can verify these engineered pathways using chronoamperometry, which provides direct measurement of electron transfer rates to exogenous acceptors. This approach offers valuable insights for both fundamental research on photosynthetic electron transport and applied research aimed at developing bio-electrochemical devices that harness photosynthetic electron flow .

How can transcriptomic analysis inform our understanding of photosystem function in different genetic backgrounds of Populus deltoides?

Transcriptomic analysis provides powerful insights into photosystem function across different genetic backgrounds of Populus deltoides. Comparative studies between monoclonal and polyclonal stands reveal significant differences in gene expression patterns that impact photosynthetic performance and productivity .

Methodologically, RNA-Seq combined with RT-qPCR validation offers a comprehensive approach. Key genes showing differential expression include DREB1A (Potri.015G136400), which exhibited a 6.95 ± 4.38 fold increase in polyclonal plots compared to 1.75 ± 0.804 in monoclonal plots . Similarly, EXO70H7 (Potri.001G234600) and OS3 (LOC7491986) showed higher expression in polyclonal stands, suggesting potential benefits of genetic diversity for photosynthetic function .

When implementing this approach, researchers should be aware of potential discrepancies between RT-qPCR and RNA-Seq results, which may arise from variations in biological replicates, sampling limitations, or temporal differences between plots. Incorporating multiple time points for gene expression analysis, especially as trees mature, can provide more robust insights into genomic interactions within different P. deltoides planting schemes .

What factors might affect the accuracy of photosystem protein purification and how can they be mitigated?

Several factors can affect the accuracy of photosystem protein purification, particularly for membrane-embedded components like the Q(B) protein. The hydrophobic nature of these proteins presents significant challenges for maintaining native structure and function during isolation.

When purifying recombinant Photosystem Q(B) protein, researchers should carefully select detergents that effectively solubilize the protein while preserving its structural integrity. The choice between mild detergents (like digitonin) and stronger solubilizing agents depends on the specific experimental requirements . For functional studies, milder conditions are preferred to maintain protein-protein interactions, while structural studies may require more robust solubilization.

Protein stability during purification can be enhanced by incorporating glycerol (50%) in storage buffers, as recommended for recombinant Populus deltoides Photosystem Q(B) protein . Additionally, maintaining appropriate temperature conditions throughout the purification process is critical, as membrane proteins are particularly susceptible to denaturation. Working at 4°C and minimizing freeze-thaw cycles can significantly improve protein quality and experimental reproducibility.

What controls should be included when analyzing gene expression of photosystem components?

When analyzing gene expression of photosystem components, several crucial controls must be included to ensure reliable results. First, appropriate reference genes with stable expression across experimental conditions are essential - for Populus deltoides studies, Ubiquitin gene (UBQ; Potri.011G134200.1) has been validated as a suitable reference for normalizing expression of target transcripts .

Technical controls should include no-template controls and no-reverse transcriptase controls to detect potential contamination or genomic DNA amplification. For RT-qPCR validation of RNA-Seq results, multiple biological replicates (minimum three) and technical replicates (three per RNA sample) are recommended . Additionally, a dissociation curve analysis should be performed after each real-time quantitative PCR run to validate specific amplification and check for primer-dimer formation .

When comparing different experimental conditions (such as monoclonal vs. polyclonal stands), consistency in sampling is critical. Temporal differences between sampled plots can influence gene expression results despite efforts to minimize variability, suggesting that incorporating additional plots across time points could account for broader genotype-specific contributions .

What methodological approaches can differentiate between effects on Q(B) formation versus Q(B)H2 release in inhibition studies?

Differentiating between effects on Q(B) formation versus Q(B)H2 release in inhibition studies requires specialized experimental approaches targeting specific aspects of the electron transport process. One effective strategy involves comparing the effects of inhibitors on electron transport rates versus proton uptake measurements .

Formate inhibition studies provide an instructive example - quantum mechanical/molecular mechanical analyses revealed that formate ligation to Fe2+ did not significantly affect the protonation of reduced Q(B), suggesting that formate inhibits Q(B)H2 release rather than its formation . This finding demonstrates the importance of examining multiple parameters of the electron transport process.

Methodologically, researchers can use site-directed mutagenesis to modify specific residues involved in either Q(B) binding/reduction or Q(B)H2 release, then observe how different inhibitors affect these modified systems. Additionally, kinetic measurements that can distinguish between the formation of intermediates (Q(B)- - and Q(B)H-) versus the final product (Q(B)H2) provide valuable insights into the specific step affected by inhibitors.

How might systems biology approaches advance our understanding of photosystem function in Populus deltoides?

Systems biology approaches offer tremendous potential for advancing our understanding of photosystem function in Populus deltoides by integrating multiple layers of biological information. Future research should prioritize combining transcriptomics with additional -omics approaches, such as proteomics, metabolomics, and SNP calling from whole genome sequencing, to develop a comprehensive understanding of photosynthetic processes .

This integrated approach would enable researchers to pinpoint genetic variations in candidate genes and identify genetic markers associated with specific productivity traits. By correlating transcriptional changes with downstream biological processes, researchers could develop a systems-level understanding of how genetic diversity influences photosynthetic efficiency and productivity in different environmental contexts .

Practically, this would involve designing experiments that collect samples for multiple types of analyses from the same experimental subjects, ensuring data integration across different biological levels. Time-series experiments would be particularly valuable for understanding dynamic responses to environmental changes and developmental stages.

What are promising approaches for engineering enhanced electron transport in Photosystem II for biotechnological applications?

Engineering enhanced electron transport in Photosystem II presents exciting opportunities for biotechnological applications, particularly in bio-electrochemical systems. Research has demonstrated that strategic modifications to the Q(A) binding environment can redirect electron flow to exogenous electron acceptors, bypassing the natural Q(A)- - to Q(B) pathway .

Promising approaches include truncating protein components that influence the distance between electron carriers, as demonstrated by manipulating the PsbT subunit C-terminus . Structure-guided mutagenesis targeting specific amino acid residues that affect quinone binding and electron transfer rates offers another powerful strategy. These approaches could be combined with the introduction of artificial electron conduits that facilitate direct electron extraction from the photosystem.

Future research should focus on optimizing these engineered pathways for specific applications, such as bio-solar cells or light-driven synthesis of high-value chemicals. The integration of recombinant photosystem components with nanomaterials and electrodes represents a particularly promising direction for developing more efficient bio-hybrid devices.

How can our understanding of proton-coupled electron transfer in Q(B) inform broader research on biological energy conversion?

Our understanding of proton-coupled electron transfer in the Q(B) protein offers valuable insights for broader research on biological energy conversion systems. The detailed mechanistic model for Q(B) reduction, including the identification of specific proton transfer pathways and the role of key amino acid residues, provides a blueprint for investigating similar processes in other biological and artificial systems .

Future research should explore how the principles of proton-coupled electron transfer observed in Photosystem II can be applied to the design of artificial photosynthetic systems and catalysts for energy conversion. The role of bicarbonate as a proton shuttle and the contribution of specific hydrogen-bonding networks to the stability of reaction intermediates represent particularly valuable insights for biomimetic chemistry .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.