Recombinant Populus trichocarpa ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific format requirements. Please indicate your preference when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To minimize degradation, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
atpI; Poptr_cp008; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Target Names
atpI
Target Protein Sequence
MNVLSYSINTLKGLYEISGVEVGQHFYWKIGGFQVHAQVLITSWVVIVILLGSAIVTVRN PQTIPTDGQNFFEYILEFIRDVSKTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWKII ELPHGELAAPTNDINTTVALALLTSIAYFYAGLSKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
This protein plays a crucial role in proton translocation across the membrane as a key component of the proton channel.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does ATP synthase subunit a (atpI) differ from other ATP synthase subunits?

ATP synthase subunit a (atpI) is structurally and functionally distinct from other ATP synthase subunits. Unlike the catalytic F1 subunits (α, β, γ, δ, ε) that directly participate in ATP synthesis, subunit a is part of the membrane-embedded FO sector along with subunits b and c. Specifically, subunit a works in conjunction with the c-ring to facilitate proton translocation across the membrane. While subunit c forms an oligomeric ring structure, subunit a provides the proton access channel that connects the lumen side to the c-ring's proton binding sites. This arrangement allows protons to flow through subunit a and interact with the c-ring, driving its rotation and subsequently powering ATP synthesis via conformational changes in the F1 sector .

The unique role of subunit a in proton channeling involves several specialized structural features not found in other subunits, including specific charged residues that form the proton pathway. This subunit's critical importance is underscored by its high conservation across species, with significant sequence similarity between Populus trichocarpa and other plant atpI proteins, reflecting evolutionary constraints on its functional domains.

What expression systems are commonly used for recombinant production of chloroplastic ATP synthase subunits?

Several expression systems have been successfully employed for recombinant production of chloroplastic ATP synthase subunits, each with specific advantages depending on research objectives. The most effective approaches include:

  • E. coli Expression Systems:

    • BL21(DE3) derivatives are most commonly used due to their high expression levels and cost-effectiveness

    • Specialized strains like C41(DE3) or C43(DE3) are preferred for membrane proteins like atpI

    • Expression typically involves fusion partners (such as MBP) to enhance solubility of hydrophobic proteins

  • Yeast Expression Systems:

    • Pichia pastoris offers advantages for eukaryotic post-translational modifications

    • Saccharomyces cerevisiae can be used for proteins requiring specific eukaryotic processing

  • Insect Cell Systems:

    • Baculovirus expression systems provide a eukaryotic environment for complex proteins

    • Better suited for multi-subunit assemblies rather than individual subunits

  • Cell-Free Expression Systems:

    • Useful for proteins that may be toxic to host cells

    • Allow direct incorporation into artificial membrane environments

For Populus trichocarpa atpI specifically, E. coli systems with membrane protein specialization represent the most practical approach, typically utilizing a fusion protein strategy to enhance solubility. The hydrophobic nature of atpI requires careful optimization of expression conditions, including reduced temperature during induction (16-20°C) and extended expression times (24-72 hours) .

What are the challenges in producing functional recombinant ATP synthase components?

Producing functional recombinant ATP synthase components like Populus trichocarpa atpI presents several significant challenges that researchers must address through specialized methodologies:

  • Membrane Protein Solubility:

    • ATP synthase subunit a is highly hydrophobic with multiple transmembrane domains

    • Tendency to aggregate or form inclusion bodies during expression

    • Requires fusion partners (MBP, SUMO) or specialized solubilization strategies

  • Proper Folding:

    • Complex folding requirements for membrane-spanning regions

    • Need for specific lipid environments to achieve native conformation

    • Challenges in refolding from denatured states after purification

  • Post-translational Modifications:

    • Potential requirements for specific modifications not produced in heterologous systems

    • Possible disulfide bond formation or other oxidative modifications

  • Functional Reconstitution:

    • Difficulties incorporating purified protein into lipid bilayers in correct orientation

    • Challenges in assembling complete functional complexes from individual subunits

    • Need for specialized liposome preparation techniques

  • Stability During Purification:

    • Maintaining structural integrity during detergent solubilization

    • Finding appropriate detergent conditions that preserve function

    • Preventing degradation during purification steps

Researchers have developed several strategies to overcome these challenges, including: (1) using specialized E. coli strains optimized for membrane protein expression, (2) employing mild detergents like n-dodecyl-β-D-maltoside (DDM) for extraction, (3) carefully controlling temperature and expression rates, and (4) verifying functional integrity through specific activity assays .

How do the redox regulation mechanisms of ATP synthase differ between Populus trichocarpa and other model plant systems?

Redox regulation of ATP synthase represents a critical control mechanism for photosynthetic energy conversion that may exhibit significant variations between Populus trichocarpa and other model plant systems. These differences reflect adaptations to specific ecological niches and life histories.

In Arabidopsis, redox regulation primarily occurs through thioredoxin-mediated modulation of the γ subunit, which contains conserved cysteine residues (Cys199-Cys205) that form an intrapeptide disulfide bond upon oxidation . This regulation functions as a light-dependent switch, with distinct regulatory properties between two γ subunit homologs:

  • γ1 (encoded by ATPC1): Shows classical light-induced redox regulation

  • γ2 (encoded by ATPC2): Remains reduced under physiological conditions, maintaining activity in both light and dark

While specific information on Populus trichocarpa ATP synthase redox regulation is limited, as a woody perennial plant adapted to diverse seasonal conditions, it likely exhibits distinctive regulatory features:

  • Regulatory Thiol Redox Potentials:

    • The midpoint potential of regulatory thiols in Populus may differ from herbaceous plants

    • These differences would affect the ATP synthase activation threshold in response to proton motive force

    • Adaptations may allow fine-tuning of ATP synthesis rates to match seasonal demands

  • Tissue-Specific Regulation Patterns:

    • Unlike annual plants, Populus must manage energy conversion across complex tissues including wood

    • Expression patterns of regulatory subunits may be more specialized to accommodate dormancy cycles

    • Distinct regulation may occur in photosynthetic vs. non-photosynthetic tissues

  • Seasonal Adaptation Mechanisms:

    • Regulatory properties may shift seasonally to support dormancy and growth resumption

    • Specialized redox control would enable energy management during overwintering

These regulatory differences enable perennial woody plants like Populus to optimize energy conversion throughout their long lifespan under variable environmental conditions, representing important adaptations distinct from annual herbaceous models like Arabidopsis .

What methodological approaches are most effective for studying the structure-function relationship of Populus trichocarpa atpI?

Studying the structure-function relationship of Populus trichocarpa atpI requires a multidisciplinary approach combining biochemical, biophysical, and computational methods. The most effective methodological strategies include:

  • Site-Directed Mutagenesis and Functional Analysis:

    • Systematic mutation of conserved residues predicted to be involved in proton translocation

    • Creation of chimeric proteins combining domains from different species

    • Functional assessment through reconstitution and activity assays

  • Advanced Structural Biology Techniques:

    • Cryo-electron microscopy for high-resolution structural determination

    • Solid-state NMR for analyzing protein dynamics in membrane environments

    • Hydrogen/deuterium exchange mass spectrometry to identify conformational changes

  • Spectroscopic Approaches:

    • Fluorescence spectroscopy using environment-sensitive probes

    • EPR spectroscopy with site-directed spin labeling

    • FTIR spectroscopy to analyze protonation states of key residues

  • Computational Methods:

    • Molecular dynamics simulations of atpI within lipid bilayers

    • Quantum mechanics/molecular mechanics calculations for proton transfer energetics

    • Evolutionary coupling analysis to identify functionally linked residue pairs

  • In vitro Reconstitution Systems:

    • Proteoliposome reconstitution with defined lipid compositions

    • Co-reconstitution with other ATP synthase subunits

    • Measurement of proton translocation using pH-sensitive fluorescent dyes

These methodologies should be applied complementarily, as each provides different aspects of structure-function relationships. A typical research workflow might begin with computational prediction of key functional residues, followed by mutagenesis and functional characterization, with structural studies providing validation of mechanistic hypotheses .

How can researchers effectively investigate the interaction between Populus trichocarpa atpI and other ATP synthase subunits?

Investigating the interactions between Populus trichocarpa atpI and other ATP synthase subunits requires specialized approaches that address the challenges of studying membrane protein complexes. The most effective methodological strategies include:

  • Co-immunoprecipitation and Pull-down Assays:

    • Use anti-atpI antibodies or tagged recombinant atpI to identify interaction partners

    • Apply chemical crosslinking before extraction to capture transient interactions

    • Employ mass spectrometry for identification of co-precipitated proteins

  • Proximity-based Labeling Methods:

    • BioID or APEX2 fusion proteins to identify proteins in close proximity to atpI

    • Spatial identification of interaction networks within the native membrane environment

    • Time-resolved labeling to capture dynamic interaction changes

  • Fluorescence-based Interaction Analysis:

    • Förster Resonance Energy Transfer (FRET) between labeled subunits

    • Fluorescence Recovery After Photobleaching (FRAP) to measure mobility and complex formation

    • Split fluorescent protein complementation to visualize interactions in vivo

  • Cryo-electron Microscopy:

    • Direct visualization of subunit arrangements within the ATP synthase complex

    • Identification of interface regions between atpI and other subunits

    • Analysis of conformational changes during the catalytic cycle

  • Genetic Approaches:

    • Suppressor mutation analysis to identify functional interactions

    • Directed evolution to select for enhanced interaction properties

    • CRISPR/Cas9 editing to introduce modified interaction domains

The successful application of these methods requires careful attention to the membrane environment, as interactions between ATP synthase subunits are highly dependent on lipid composition and membrane properties. Mild detergents or membrane-mimetic systems (nanodiscs, liposomes) should be used to maintain native-like conditions during analysis .

What experimental approaches can be used to study the role of Populus trichocarpa atpI in proton channeling?

Studying proton channeling through Populus trichocarpa atpI requires specialized experimental approaches that address both structural and functional aspects of this critical process. The most effective strategies include:

  • Site-Directed Mutagenesis of Proton Channel Residues:

    • Identification and mutation of conserved charged residues within predicted transmembrane domains

    • Creation of systematic alanine scanning mutations across channel-forming regions

    • Expression and purification of mutant proteins for functional testing

  • Proton Translocation Assays:

    • Reconstitution of wild-type and mutant atpI into liposomes containing pH-sensitive fluorescent dyes

    • Measurement of proton translocation rates upon establishment of membrane potential

    • Quantification of the effects of specific mutations on proton movement kinetics

  • Electrophysiological Measurements:

    • Patch-clamp techniques on proteoliposomes containing recombinant atpI

    • Single-channel conductance recordings to directly measure proton movement

    • Analysis of ion selectivity and gating properties

  • Biophysical Characterization of Proton Pathways:

    • Hydrogen/deuterium exchange mass spectrometry to identify water-accessible regions

    • NMR studies of protonation/deprotonation events at key residues

    • Time-resolved FTIR spectroscopy to track proton movement through the channel

The effects of mutations in key residues can be systematically analyzed using the following experimental framework:

Residue TypePredicted FunctionExperimental ApproachExpected Outcome of Mutation
Conserved arginine residuesProton pathway formationProton translocation assaysComplete loss of proton movement
Polar residues in transmembrane domainsWater coordination in channelH/D exchange MSAltered exchange kinetics in pathway
Interface residues with c-ringCoupling proton movement to rotationATP synthesis assaysUncoupling of proton flow from catalysis
Conserved glutamate residuesProton binding/releasepH-dependent spectroscopyAltered pH dependence of activity

Through systematic application of these approaches, researchers can construct a comprehensive model of proton channeling through atpI and its coupling to ATP synthesis .

What evolutionary insights can be gained from comparative analysis of atpI across plant species?

Comparative analysis of atpI across plant species provides valuable evolutionary insights into the adaptation and optimization of photosynthetic energy conversion. Populus trichocarpa atpI, as a representative from woody perennial plants, offers a unique perspective in this evolutionary landscape.

Key evolutionary insights include:

  • Conservation Patterns:

    • Transmembrane domains of atpI show higher conservation compared to loop regions

    • Proton channel-forming residues are nearly invariant across diverse plant lineages

    • Interface regions with other subunits exhibit lineage-specific adaptations

  • Selection Pressure Analysis:

    • dN/dS ratio analysis reveals strong purifying selection on functional domains

    • Certain residues, particularly in regions facing the lipid bilayer, show signatures of positive selection

    • These sites of positive selection may correlate with adaptation to specific environmental conditions

  • Co-evolution with Other Subunits:

    • Coordinated evolution between atpI and interacting subunits maintains structural compatibility

    • Compensatory mutations across subunit interfaces preserve essential functional interactions

    • These patterns highlight the constraints imposed by the need for precise structural assembly

  • Adaptation to Different Photosynthetic Strategies:

    • Variations in atpI sequence correlate with differences in photosynthetic efficiency across plant lineages

    • C3, C4, and CAM plants show distinctive patterns in residues affecting proton translocation efficiency

    • These differences reflect optimization for diverse carbon fixation pathways

  • Lineage-Specific Evolutionary Patterns:

    • Woody perennials like Populus show distinct evolutionary signatures compared to herbaceous plants

    • These differences may reflect adaptation to longer lifespans and seasonal environmental variations

    • The slower generation time of trees may influence the rate and pattern of atpI evolution

Populus trichocarpa atpI specifically contributes to our understanding of ATP synthase evolution by representing adaptations to woody perennial lifestyle with its specific requirements for energy production during seasonal changes and long-term growth strategies.

How does the functional assembly of ATP synthase differ between photosynthetic and non-photosynthetic tissues in Populus?

The functional assembly of ATP synthase exhibits important tissue-specific differences between photosynthetic and non-photosynthetic tissues in Populus, reflecting distinct metabolic requirements across plant organs. These differences parallel findings in Arabidopsis but likely show adaptations specific to woody perennial plants.

Key differences include:

  • Subunit Composition and Expression:

    • Photosynthetic tissues (leaves): Higher expression of ATP synthase genes optimized for light-driven synthesis

    • Non-photosynthetic tissues (roots, wood): Differential expression patterns supporting primarily ATP hydrolysis functions

    • Tissue-specific promoter activity regulating the abundance of components including atpI

  • Regulatory Subunit Isoforms:

    • Based on findings in Arabidopsis, photosynthetic tissues likely express redox-sensitive γ1-equivalent subunits

    • Non-photosynthetic tissues may preferentially express redox-insensitive γ2-equivalent subunits

    • This specialization enables tissue-appropriate regulation, with photosynthetic tissues showing light responsiveness and non-photosynthetic tissues maintaining activity regardless of light conditions

  • Post-translational Modifications:

    • Distinct phosphorylation patterns between leaf and stem/root ATP synthase

    • Tissue-specific redox modifications reflecting different metabolic environments

    • These modifications fine-tune enzyme activity to meet tissue-specific demands

  • Membrane Environment:

    • Thylakoid membrane localization with specific lipid composition in photosynthetic tissues

    • Plastid envelope or internal membrane localization in non-photosynthetic plastids

    • Different lipid environments influencing complex assembly and activity

These tissue-specific adaptations have evolved to support the complex physiology of trees, including:

  • Seasonal Energy Management:

    • Specialized regulation in woody tissues supporting dormancy transitions

    • Maintenance of critical energy functions during winter in perennial structures

  • Tree-Specific Physiological Processes:

    • Support for secondary growth and wood formation

    • Facilitation of long-distance transport processes

    • Adaptation to the higher respiratory demands of woody tissues

These differences highlight how ATP synthase assembly has been optimized to support the diverse physiological requirements across tissues in complex perennial plants like Populus .

How can researchers optimize heterologous expression systems for Populus trichocarpa atpI?

Optimizing heterologous expression of Populus trichocarpa atpI presents unique challenges due to its hydrophobic nature as a membrane protein. Based on successful approaches with similar proteins, researchers should implement the following optimization strategies:

  • Expression System Selection:

    • E. coli strains specialized for membrane proteins (C41(DE3), C43(DE3)) show significantly improved yields

    • Eukaryotic systems like Pichia pastoris may better support proper folding

    • Cell-free expression systems allow direct incorporation into artificial membranes

  • Vector and Fusion Partner Design:

    • Fusion partners significantly enhance solubility (MBP shows 4-8 fold improvement for similar proteins)

    • Optimal placement of purification tags affects yield and functionality

    • Strategic incorporation of protease cleavage sites for tag removal

  • Expression Parameter Optimization:

    • Reduced temperature during induction (16-20°C) improves proper folding by 3-5 fold

    • Low inducer concentrations (0.1-0.2 mM IPTG) prevent overwhelming membrane insertion machinery

    • Extended expression times (24-72 hours) maximize yield without significant degradation

The following table summarizes optimization parameters and their effects on atpI expression:

ParameterConventional ConditionsOptimized ConditionsExpected Improvement
Induction temperature37°C18°C3-5 fold increase in functional protein
IPTG concentration1.0 mM0.1-0.2 mM2 fold increase in proper folding
Induction duration4-6 hours16-24 hours2-3 fold increase in total yield
Media compositionLBTB + 1% glucose2 fold increase in biomass and yield
Fusion partnerNone or His-tag onlyMBP fusion4-8 fold increase in solubility

Purification should employ a two-step approach: affinity chromatography followed by size exclusion chromatography in the presence of appropriate detergents (typically DDM or LMNG at concentrations just above their critical micelle concentration). This strategy typically results in >90% pure protein suitable for structural and functional studies .

What approaches can be used for functional reconstitution of recombinant atpI into liposomes?

Functional reconstitution of recombinant Populus trichocarpa atpI into liposomes requires careful methodological approaches to maintain protein structure and function during the transition from detergent-solubilized state to lipid bilayer environment. The most effective reconstitution strategies include:

  • Protein Preparation:

    • Purification using mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG)

    • Verification of protein integrity through circular dichroism spectroscopy

    • Concentration determination accounting for detergent interference in protein assays

  • Lipid Selection and Preparation:

    • Use of plant thylakoid-mimicking lipid mixtures (MGDG, DGDG, SQDG, PG)

    • Alternative simplified mixtures (DOPC:DOPG at 7:3 ratio) for initial studies

    • Preparation of unilamellar vesicles through extrusion or sonication

  • Reconstitution Methods:

    • Detergent dialysis: Gradual removal of detergent through extensive dialysis (48-72 hours)

    • Bio-Beads adsorption: Controlled removal using hydrophobic beads

    • Direct incorporation during liposome formation for cell-free expressed protein

  • Verification of Successful Reconstitution:

    • Freeze-fracture electron microscopy to visualize protein incorporation

    • Protease protection assays to determine orientation

    • Fluorescence recovery after photobleaching (FRAP) to assess mobility

  • Functional Assessment:

    • pH-sensitive dye encapsulation (ACMA, pyranine) for proton translocation measurements

    • Membrane potential-sensitive probes to monitor electrochemical gradient formation

    • Co-reconstitution with complementary ATP synthase subunits for activity measurements

For bioenergetic studies specifically, researchers should incorporate proton pumps (such as bacteriorhodopsin) or use artificial pH gradients to energize the system. The efficiency of reconstitution can be optimized by controlling the protein:lipid ratio, typically starting with 1:200 to 1:1000 (w/w) ratios and adjusting based on experimental requirements .

How can advanced structural techniques like cryo-EM be applied to study Populus trichocarpa atpI?

Cryo-electron microscopy (cryo-EM) has revolutionized structural studies of membrane proteins and can provide unprecedented insights into Populus trichocarpa atpI structure and function when applied with appropriate methodological considerations:

  • Sample Preparation Strategies:

    • Detergent-solubilized protein: Selection of detergents compatible with cryo-EM (LMNG, GDN)

    • Nanodisc incorporation: Embedding atpI in MSP nanodiscs with native-like lipid composition

    • Liposome reconstitution: Small unilamellar vesicles with controlled protein density

    • Amphipol stabilization: Alternative to detergents for maintaining native structure

  • Cryo-EM Specific Optimizations:

    • Vitrification conditions: Optimization of blotting time and temperature

    • Grid selection: Graphene oxide or ultrathin carbon supports to improve particle orientation

    • Phase plate implementation: Enhanced contrast for smaller membrane proteins

    • Data collection strategies: Beam-tilt series to increase information content

  • Image Processing Approaches:

    • 2D classification to identify different conformational states

    • 3D classification to separate heterogeneous populations

    • Focused refinement on atpI domain to improve local resolution

    • Signal subtraction to enhance resolution of specific regions

  • Integrative Structural Analysis:

    • Combination with molecular dynamics simulations

    • Validation using complementary techniques (crosslinking-MS, EPR)

    • Integration with functional data from mutagenesis studies

  • Specific Insights Obtainable:

    • High-resolution structure of the proton channel architecture

    • Visualization of water molecules within the proton pathway

    • Identification of lipid-protein interactions at the molecular level

    • Capturing different conformational states related to the catalytic cycle

For maximal success, researchers should consider studying atpI within the context of the complete ATP synthase complex rather than in isolation, as this provides stabilization and crucial structural context. Recent advances in cryo-EM have achieved resolutions approaching 2.5-3.0 Å for related membrane protein complexes, sufficient to resolve side chain conformations critical for mechanistic understanding .

What are the future research directions for Populus trichocarpa atpI studies?

Research on Populus trichocarpa ATP synthase subunit a (atpI) is poised for significant advances, with several promising directions for future investigation that build upon current understanding while addressing important knowledge gaps:

  • High-Resolution Structural Studies:

    • Application of advanced cryo-EM techniques to determine atomic-resolution structures

    • Comparative structural analysis across different plant lineages

    • Investigation of conformational changes during the catalytic cycle

  • Systems Biology Integration:

    • Comprehensive analysis of ATP synthase regulation within the photosynthetic apparatus

    • Investigation of coordination between nuclear and chloroplast-encoded subunits

    • Network analysis of interactions with other thylakoid protein complexes

  • Environmental Adaptation Research:

    • Comparative studies across Populus species from diverse habitats

    • Analysis of ATP synthase function under stress conditions relevant to climate change

    • Investigation of seasonal regulation in perennial woody plants

  • Synthetic Biology Applications:

    • Engineering optimized ATP synthase variants for enhanced photosynthetic efficiency

    • Development of ATP synthase-based biosensors for monitoring energetic status

    • Creation of minimal synthetic systems for bioenergetic research

  • Translational Research Opportunities:

    • Application of knowledge to improve crop photosynthetic efficiency

    • Development of ATP synthase-targeted approaches for stress resilience

    • Utilization of ATP synthase components in bioenergy applications

These research directions reflect the critical importance of ATP synthase in plant energy metabolism and the potential for advances in our understanding of atpI to contribute to both fundamental science and applied technologies for sustainable agriculture and bioenergy production .

How does understanding Populus trichocarpa atpI contribute to broader plant bioenergetics research?

Understanding Populus trichocarpa atpI contributes significantly to broader plant bioenergetics research by providing insights into energy conversion processes in a model woody perennial plant with distinct physiological and ecological characteristics. These contributions extend across multiple dimensions of plant science:

  • Evolutionary Perspectives:

    • Insights into ATP synthase adaptation across plant lineages with different life histories

    • Understanding of how energy conversion mechanisms evolved to support diverse plant forms

    • Recognition of conserved mechanisms versus lineage-specific adaptations

  • Physiological Integration:

    • Elucidation of how ATP synthesis coordinates with carbon fixation in woody plants

    • Understanding of energy partition across diverse tissues including wood formation

    • Insights into seasonal regulation of bioenergetics in perennial plants

  • Stress Adaptation Mechanisms:

    • Identification of ATP synthase adjustments during environmental challenges

    • Understanding of energy homeostasis maintenance during drought, temperature extremes

    • Insights into long-term versus short-term adaptive responses

  • Methodological Advances:

    • Development of approaches for studying membrane protein complexes in recalcitrant systems

    • Establishment of reconstitution methods applicable to diverse plant species

    • Creation of analytical frameworks for complex multimeric enzyme assemblies

  • Translational Applications:

    • Application to crop improvement through enhanced energy conversion efficiency

    • Development of strategies for engineering stress-resistant photosynthetic apparatus

    • Inspiration for biomimetic energy conversion technologies

By serving as a bridge between model herbaceous plants and ecologically important tree species, research on Populus trichocarpa atpI contributes to a more comprehensive understanding of plant bioenergetics across diverse plant forms and environmental contexts .

What is the recommended protocol for purification of recombinant Populus trichocarpa atpI?

The following detailed protocol is recommended for purification of recombinant Populus trichocarpa atpI, based on successful approaches with similar membrane proteins:

Materials Required:

  • Recombinant expression system (optimally E. coli C41(DE3) with MBP-atpI fusion)

  • Lysis buffer: 50 mM Tris-HCl pH 7.5, 200 mM NaCl, 10% glycerol, 1 mM EDTA, protease inhibitors

  • Solubilization buffer: Lysis buffer + 1% DDM (n-dodecyl-β-D-maltoside)

  • Column buffer: 50 mM Tris-HCl pH 7.5, 200 mM NaCl, 10% glycerol, 0.05% DDM

  • Size exclusion buffer: 20 mM HEPES pH 7.4, 150 mM NaCl, 5% glycerol, 0.03% DDM

Procedure:

  • Cell Lysis and Membrane Preparation:

    • Harvest cells by centrifugation (6,000 × g, 15 min, 4°C)

    • Resuspend in lysis buffer (10 mL per gram of wet cell paste)

    • Disrupt cells via sonication or high-pressure homogenization

    • Remove unbroken cells and debris (10,000 × g, 20 min, 4°C)

    • Collect membranes by ultracentrifugation (150,000 × g, 1 hour, 4°C)

    • Resuspend membrane pellet in lysis buffer (5 mL per gram of original cell paste)

  • Protein Solubilization:

    • Add solubilization buffer to membrane suspension (1:1 v/v)

    • Incubate with gentle rotation for 2 hours at 4°C

    • Remove insoluble material by ultracentrifugation (150,000 × g, 30 min, 4°C)

    • Collect supernatant containing solubilized protein

  • Affinity Purification:

    • Apply supernatant to equilibrated amylose resin for MBP-atpI fusion

    • Wash with 10 column volumes of column buffer

    • Elute with column buffer containing 10 mM maltose

    • Concentrate protein using 50 kDa MWCO concentrator

  • Tag Removal (Optional):

    • Add TEV protease at 1:50 ratio (protease:protein)

    • Incubate overnight at 4°C

    • Remove cleaved tag by reverse affinity chromatography

  • Size Exclusion Chromatography:

    • Apply protein to Superdex 200 column equilibrated with size exclusion buffer

    • Collect peak fractions corresponding to monomeric atpI

    • Verify purity by SDS-PAGE and Western blotting

  • Functional Verification:

    • Circular dichroism to confirm alpha-helical secondary structure

    • Reconstitution into liposomes for functional assays

    • Storage at -80°C in single-use aliquots with 10% glycerol

This protocol typically yields 0.5-1.5 mg of purified protein per liter of bacterial culture with >90% purity. The protein should be maintained at 4°C throughout the purification process and exposure to high temperatures or freeze-thaw cycles should be minimized .

How can researchers design effective site-directed mutagenesis experiments for Populus trichocarpa atpI?

Designing effective site-directed mutagenesis experiments for Populus trichocarpa atpI requires careful consideration of protein structure, function, and experimental objectives. The following comprehensive approach ensures meaningful results:

Target Selection Strategy:

  • Functional Domain Analysis:

    • Identify conserved residues through multiple sequence alignment across species

    • Focus on charged residues (Arg, Lys, Glu, Asp) within predicted transmembrane regions

    • Prioritize residues matching consensus proton channel motifs

    • Consider residues at predicted interfaces with other ATP synthase subunits

  • Structural Prediction Guidance:

    • Use homology modeling based on related ATP synthase structures

    • Identify residues lining potential proton pathways

    • Consider residues at lipid-protein interfaces

    • Evaluate potential conformational hinge points

  • Systematic Mutation Design:

Mutation TypePurposeExample Design
Alanine scanningAssess importance of side chainsSystematic replacement of channel-lining residues
Conservative substitutionsProbe specific physicochemical propertiesArg→Lys to maintain charge but alter size
Charge reversalTest electrostatic interactionsAsp→Lys to reverse local electrostatics
Cysteine substitutionEnable chemical modification studiesIntroduction at solvent-accessible positions
Domain swappingTest functional exchangeabilityReplace transmembrane segments with those from related species
  • Experimental Controls:

    • Include known inactive mutations as negative controls

    • Create mutations outside functional domains as neutral controls

    • Design back-mutations to verify phenotype reversibility

Technical Implementation:

  • Mutagenesis Method Selection:

    • QuikChange PCR for single mutations

    • Gibson Assembly for multiple simultaneous mutations

    • Golden Gate Assembly for combinatorial mutation libraries

  • Verification Strategy:

    • Complete sequencing of the entire coding region

    • Expression level verification by Western blotting

    • Structural integrity assessment via CD spectroscopy

  • Functional Analysis Framework:

    • Systematic comparison of wild-type and mutant proteins

    • Multiple independent protein preparations for statistical validity

    • Quantitative rather than qualitative functional assays

  • Analytical Workflow:

    • Initial screening in simplified assay systems

    • Detailed characterization of phenotype-altering mutations

    • Integration of results into structural models

This systematic approach maximizes the information obtained from mutagenesis experiments while minimizing resources spent on uninformative mutations. The results should be interpreted in the context of existing structural and functional knowledge about ATP synthase .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.