Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_1070325 (POPTRDRAFT_1070325)

What is the Populus trichocarpa CASP-like protein POPTRDRAFT_1070325?

The POPTRDRAFT_1070325 is a CASP-like protein derived from Populus trichocarpa (Western balsam poplar), also known as Populus balsamifera subsp. trichocarpa. It is identified in the UniProt database under accession number B9GHX8. This full-length protein comprises 230 amino acids with a characteristic sequence that includes multiple proline-rich regions, particularly in the C-terminal domain. The amino acid sequence is characterized by a specific pattern: MEKKDEGNPPMAVMGSRDENEDVKSTMRTAET(m)LRLVPVALCVSALVV(m)LKNTQTNDYGSLSYSDLGAFRYLVNANGICAGYSLLSAVIVAMPRAWTMPQAWTFFLLDQVLTYVILAAGTV STEVLYLANKGDTSIAWSAACVSFGGFCHKALISTVITFVAVIFYAALSLVSSYKLFS KYDAPVVTQSGEGIKTVTLGSPPPPPPPPPSNLHLHLHAKLACPAHNNSPN .

What are the optimal storage conditions for Recombinant Populus trichocarpa CASP-like protein?

For optimal results in experimental applications, the recombinant protein should be stored at -20°C in a Tris-based buffer containing 50% glycerol, which has been specifically optimized for this protein. For extended preservation, storage at -80°C is recommended. When working with the protein, it is crucial to avoid repeated freeze-thaw cycles as these can compromise protein integrity and function. Instead, prepare working aliquots and store them at 4°C for up to one week to maintain protein stability while minimizing degradation .

How do I design an experimental protocol that incorporates this recombinant protein?

When designing an experimental protocol incorporating the POPTRDRAFT_1070325 protein, follow the PICOT framework (Population, Intervention, Comparator, Outcome, Time frame) to establish a structured approach. Begin by defining your research question and hypotheses, then outline the specific aspects of the protein you aim to investigate. For protein function studies, consider the following methodology:

• Characterize baseline protein activity using purified recombinant protein

• Design comparative analyses between wild-type and mutant variants

• Establish quantifiable outcome measures (e.g., binding affinity, enzymatic activity)

• Determine appropriate time points for measurements

• Implement proper controls including:

  • Negative controls without protein

  • Positive controls with known related proteins

  • Vehicle controls to account for buffer effects

Document standardized procedures for protein handling, including thawing protocols, concentration adjustments, and storage between experimental procedures to ensure reproducibility .

What structural prediction methods are most appropriate for analyzing CASP-like proteins such as POPTRDRAFT_1070325?

For structural prediction of CASP-like proteins such as POPTRDRAFT_1070325, a multi-faceted approach yields the most reliable results. Recent advances in Critical Assessment of Structure Prediction (CASP) methodologies highlight the effectiveness of combining template-based modeling with ab initio approaches:

• Begin with homology modeling if templates with >30% sequence identity exist

• Implement contact prediction methods, which have shown two-fold improvement in accuracy in recent CASP assessments

• Apply deep learning algorithms that incorporate evolutionary information and contact prediction for regions without suitable templates

• Validate predictions through molecular dynamics simulations to assess stability

• Consider hybrid approaches that integrate experimental data (such as crosslinking or SAXS) with computational models

When selecting prediction software, prioritize those that performed well in recent CASP assessments, particularly for proteins with similar characteristics to CASP-like proteins. Note that interpretation of crosslinking data can be challenging, as backbone atoms of crosslinked residues may be separated by up to 25Å, which provides limited conformational constraints for smaller proteins .

How can I experimentally validate the predicted structure of POPTRDRAFT_1070325?

Experimental validation of POPTRDRAFT_1070325's predicted structure should employ multiple complementary techniques to increase confidence in results:

Integrate all experimental data to refine computational models using restraint-based modeling approaches. Document inconsistencies between predicted and experimental data, as these may highlight biologically significant structural dynamics .

What are the known or predicted functions of CASP-like proteins in Populus trichocarpa?

CASP-like proteins in Populus trichocarpa are believed to play crucial roles in plant cellular processes, particularly in cell wall development and response to environmental stresses. Based on sequence analysis and structural homology, the POPTRDRAFT_1070325 protein likely functions in:

• Membrane organization and integrity maintenance

• Cell wall formation and remodeling during growth

• Intercellular communication and transport

• Stress response signaling, particularly during drought or pathogen exposure

The protein's characteristic proline-rich C-terminal domain (SPPPPPPPPPSNLHLHLHAKLACPAHNNSPN) suggests potential protein-protein interaction capabilities, while its transmembrane regions indicate membrane localization. The hydrophobic regions (ALCVSALVVM) and (VITFVAVIFY) further support its predicted role in membrane functions.

To fully elucidate its function, comprehensive experimental approaches including gene knockouts/knockdowns, protein localization studies, and interaction partner identification should be implemented in model systems .

How can I determine potential interaction partners for POPTRDRAFT_1070325?

To systematically identify interaction partners of POPTRDRAFT_1070325, employ a multi-technique approach:

• Affinity Purification coupled with Mass Spectrometry (AP-MS):

  • Express tagged recombinant POPTRDRAFT_1070325 in appropriate cell systems

  • Perform pulldown experiments under varying physiological conditions

  • Identify co-purifying proteins through mass spectrometry

  • Validate interactions through reciprocal pulldowns

• Yeast Two-Hybrid (Y2H) Screening:

  • Create bait constructs with different domains of POPTRDRAFT_1070325

  • Screen against Populus trichocarpa cDNA libraries

  • Validate positive interactions through secondary assays

• Protein Microarrays:

  • Probe arrays containing potential interactors with labeled POPTRDRAFT_1070325

  • Quantify binding affinities across different conditions

• Bimolecular Fluorescence Complementation (BiFC):

  • Visualize interactions in planta through split fluorescent protein complementation

  • Determine subcellular localization of interaction complexes

After identifying potential interactors, construct a protein-protein interaction network and perform Gene Ontology enrichment analysis to identify biological processes that may involve POPTRDRAFT_1070325. Prioritize validation of interactions with proteins involved in membrane dynamics and cell wall processes, given the predicted functions of CASP-like proteins .

How can POPTRDRAFT_1070325 be used in comparative genomics studies across Populus species?

POPTRDRAFT_1070325 provides a valuable molecular marker for comparative genomics studies across Populus species. Implement the following methodological approach:

• Ortholog Identification:

  • Perform reciprocal BLAST searches to identify orthologs in related Populus species

  • Construct phylogenetic trees to visualize evolutionary relationships

  • Analyze selection pressures using dN/dS ratios to identify functionally important regions

• Synteny Analysis:

  • Examine genomic context of POPTRDRAFT_1070325 across species

  • Identify conserved gene clusters suggesting functional relationships

  • Map structural variations that may impact regulatory elements

• Expression Profiling:

  • Compare expression patterns across species using RNA-Seq data

  • Identify tissue-specific or condition-dependent expression differences

  • Correlate expression changes with environmental adaptations

• Structural Variation Analysis:

  • Characterize copy number variations and gene duplications

  • Evaluate impact of variations on protein structure using homology modeling

  • Assess functional consequences through molecular dynamics simulations

This comparative approach can reveal evolutionary adaptations in CASP-like proteins that contribute to species-specific traits, particularly those related to stress tolerance, growth patterns, and cell wall characteristics in different Populus species. Present results in phylogenetic trees accompanied by heatmaps displaying sequence conservation across functional domains .

What methodologies are appropriate for studying post-translational modifications of POPTRDRAFT_1070325?

To comprehensively characterize post-translational modifications (PTMs) of POPTRDRAFT_1070325, implement this methodological workflow:

• In Silico Prediction:

  • Use specialized algorithms to predict potential PTM sites

  • Consider common plant protein modifications: phosphorylation, glycosylation, methylation, acetylation

  • Focus on the proline-rich region (SPPPPPPPPPSNLHLHLHAKLACPAHNNSPN) which often undergoes hydroxylation in plants

• Mass Spectrometry-Based Identification:

  • Perform enrichment strategies specific to target modifications

  • Implement both bottom-up (peptide) and top-down (intact protein) proteomics

  • Use electron transfer dissociation (ETD) for labile modifications

  • Compare modifications under different physiological conditions

• Site-Directed Mutagenesis Validation:

  • Create point mutations at predicted modification sites

  • Express mutant proteins in appropriate systems

  • Compare functional parameters between wild-type and mutant proteins

• Modification-Specific Antibodies:

  • Develop antibodies against specific modifications

  • Use for western blotting and immunoprecipitation

  • Apply in immunohistochemistry to determine cellular localization of modified protein

Present findings in a comprehensive table detailing modification sites, modification types, detection methods, and potential functional implications. Include mass spectrometry spectra and extracted ion chromatograms to support identification of specific modifications .

How can I address solubility issues when working with recombinant POPTRDRAFT_1070325?

CASP-like proteins containing multiple transmembrane domains often present solubility challenges. Implement this systematic approach to optimize solubility:

• Buffer Optimization:

  • Test pH range (5.0-9.0) at 0.5 pH unit intervals

  • Evaluate various buffering agents (Tris, HEPES, phosphate)

  • Screen salt concentrations (50-500 mM NaCl)

  • Include stabilizing agents (glycerol 5-20%, trehalose 50-200 mM)

• Detergent Selection:

  • Test mild non-ionic detergents (DDM, LDAO, C12E8)

  • Evaluate zwitterionic detergents (CHAPS, FC-12)

  • Optimize detergent concentration using critical micelle concentration (CMC) as reference

• Protein Engineering Approaches:

  • Remove hydrophobic regions if not essential for function

  • Create fusion constructs with solubility-enhancing partners (MBP, SUMO, thioredoxin)

  • Design minimal functional domains based on secondary structure predictions

• Expression Conditions:

  • Lower induction temperature (16-20°C)

  • Reduce inducer concentration

  • Extend expression time (24-48 hours)

Document results in a solubility optimization matrix, recording protein yield and purity for each condition tested. Perform stability assays (thermal shift, dynamic light scattering) on solubilized protein to ensure native-like folding is maintained .

How do I interpret contradictory results in structural studies of POPTRDRAFT_1070325?

When encountering contradictory results in structural studies of POPTRDRAFT_1070325, apply this analytical framework:

• Systematic Comparison of Methodologies:

  • Create a detailed table comparing experimental conditions across studies

  • Identify variables that might influence outcomes (pH, temperature, buffer composition)

  • Evaluate sample preparation differences (expression systems, purification methods)

• Data Quality Assessment:

  • Review raw data quality metrics for each technique

  • For computational methods, examine confidence scores and validation metrics

  • For experimental methods, assess signal-to-noise ratios and reproducibility

• Biological Context Consideration:

  • Evaluate if contradictions represent genuine conformational states

  • Consider if the protein adopts different structures in different environments

  • Assess potential effects of missing binding partners or cofactors

• Integrative Modeling:

  • Develop ensemble models that incorporate all experimental constraints

  • Weight data based on reliability assessments

  • Identify regions of consensus and disagreement across methods

Present findings using a decision tree model that guides researchers through which structural model to use based on specific research questions or experimental conditions. Include a matrix showing consistency scores between different structural determination methods, highlighting areas of agreement and contradiction .

How do I formulate effective research questions for studying POPTRDRAFT_1070325 function?

Developing effective research questions for POPTRDRAFT_1070325 requires a structured approach using established frameworks:

• Apply the PICOT Framework:

  • Population: Define the biological system (e.g., specific Populus tissues, cell types)

  • Intervention: Specify manipulations of POPTRDRAFT_1070325 (e.g., overexpression, knockdown)

  • Comparator: Establish control conditions (e.g., wild-type expression, related CASP proteins)

  • Outcome: Determine measurable endpoints (e.g., changes in cell wall composition)

  • Time frame: Define developmental stages or treatment durations

• Evaluate Questions Against FINER Criteria:

  • Feasible: Ensure techniques and resources are available

  • Interesting: Address gaps in understanding of CASP-like proteins

  • Novel: Explore unexplored aspects of POPTRDRAFT_1070325 function

  • Ethical: Consider implications for sustainable forestry or biomass production

  • Relevant: Connect to broader themes in plant biology or bioenergy research

• Structure Questions Hierarchically:

  • Primary question: Address core functional aspect

  • Secondary questions: Examine mechanisms and regulations

  • Exploratory questions: Investigate unexpected observations

Example Research Question Framework: "How does POPTRDRAFT_1070325 expression in vascular cambium cells of Populus trichocarpa (P) respond to drought stress conditions (I) compared to normal watering conditions (C), affecting cell wall lignification patterns (O) during the active growth season (T)?"

This structured approach ensures research questions are both scientifically rigorous and practically answerable .

What experimental design provides the most robust data when studying protein-protein interactions involving POPTRDRAFT_1070325?

To generate robust protein-protein interaction data for POPTRDRAFT_1070325, implement this comprehensive experimental design:

• Multi-Method Validation Approach:

  Method	Strengths	Limitations	Controls Required
  Co-immunoprecipitation	Detects interactions in native context	May identify indirect interactions	IgG controls, reverse IP
  Yeast Two-Hybrid	High-throughput screening	Prone to false positives	Auto-activation controls, specificity tests
  FRET/BRET	Real-time interaction dynamics	Requires protein tagging	Donor-only and acceptor-only controls
  Split-ubiquitin assay	Suitable for membrane proteins	Limited to binary interactions	Self-activation controls
  Proximity labeling (BioID)	Identifies transient interactions	Spatial resolution limitations	Non-interacting protein controls

• Hierarchical Confirmation Strategy:

  • Tier 1: High-throughput screening to identify candidates

  • Tier 2: Secondary validation using orthogonal methods

  • Tier 3: Functional validation of biological relevance

• Controlled Variable Management:

  • Expression levels: Use inducible promoters to titrate expression

  • Cellular compartments: Include localization tags and controls

  • Environmental conditions: Test interactions under multiple conditions

• Data Integration Framework:

  • Assign confidence scores based on number of supporting methods

  • Create interaction network maps with weighted edges reflecting confidence

  • Perform gene ontology enrichment on high-confidence interactors

This multi-layered approach minimizes false positives while maximizing discovery potential, producing a high-confidence interaction network for POPTRDRAFT_1070325 .

What statistical approaches are most appropriate for analyzing differential expression of POPTRDRAFT_1070325 across conditions?

When analyzing differential expression of POPTRDRAFT_1070325 across experimental conditions, implement this statistical framework:

• Exploratory Data Analysis:

  • Assess data distribution using histograms and Q-Q plots

  • Perform variance stabilization if needed

  • Identify and handle outliers using boxplots and Cook's distance

• Statistical Testing Selection:

  • For normally distributed data with homogeneous variance:

    • Two conditions: t-test with appropriate corrections

    • Multiple conditions: ANOVA followed by post-hoc tests

  • For non-parametric approaches:

    • Two conditions: Mann-Whitney U test

    • Multiple conditions: Kruskal-Wallis followed by Dunn's test

  • For time-series data:

    • Repeated measures ANOVA or mixed-effects models

• Multiple Testing Correction:

  • Apply Benjamini-Hochberg procedure for false discovery rate control

  • Report both raw p-values and adjusted q-values

  • Use stringent thresholds for exploratory analyses (q < 0.05)

• Effect Size Calculation:

  • Report fold change (log2) in expression

  • Calculate Cohen's d or similar metrics to quantify magnitude

  • Present confidence intervals around effect size estimates

• Power Analysis:

  • Conduct post-hoc power analysis to determine if sample size was sufficient

  • Perform a priori power analysis for follow-up studies

Visualize results using volcano plots that incorporate both statistical significance and effect size. Include heat maps showing expression patterns across conditions with hierarchical clustering to identify co-regulated genes .

How can I integrate unpublished data on POPTRDRAFT_1070325 with published literature for comprehensive analysis?

To effectively integrate unpublished data on POPTRDRAFT_1070325 with published literature, implement this methodological framework:

• Systematic Evidence Synthesis:

  • Conduct comprehensive literature search using structured query terms

  • Include preprint servers and conference proceedings

  • Contact researchers directly for unpublished datasets

  • Document search strategy and inclusion criteria

• Data Harmonization Process:

  • Standardize variable names and units across datasets

  • Transform data to comparable scales when necessary

  • Document all data processing steps for transparency

  • Develop crosswalks between different experimental protocols

• Quality Assessment:

  • Evaluate methodological rigor of both published and unpublished sources

  • Assign quality scores based on standardized criteria

  • Weight evidence based on quality assessment

  • Consider risk of bias in unpublished studies

• Meta-analytical Approaches:

  • Perform quantitative synthesis where appropriate

  • Use random-effects models to account for heterogeneity

  • Conduct sensitivity analyses excluding lower-quality data

  • Test for publication bias using funnel plots

Recent systematic reviews incorporating unpublished studies showed that the median number of unpublished studies included was 1 (IQR 1-2) in non-Cochrane reviews and 3 (IQR 1-3) in Cochrane reviews, demonstrating the feasibility of this approach. Include a PRISMA-style flow diagram documenting the integration of published and unpublished sources in your final analysis .

What are the most promising research directions for understanding POPTRDRAFT_1070325 function in stress response?

Based on current knowledge gaps, the following research directions offer promising avenues for elucidating POPTRDRAFT_1070325's role in stress response:

• Systems Biology Approaches:

  • Integrate transcriptomics, proteomics, and metabolomics data

  • Develop gene regulatory networks centered on POPTRDRAFT_1070325

  • Model signaling cascades involving CASP-like proteins

• Comparative Functional Genomics:

  • Analyze expression patterns in drought-resistant vs. susceptible Populus varieties

  • Perform cross-species functional complementation studies

  • Identify evolutionary signatures of selection in stress-related domains

• In Planta Functional Characterization:

  • Develop CRISPR/Cas9-mediated knockouts or knockdowns

  • Create tissue-specific and inducible expression systems

  • Employ advanced microscopy to track protein dynamics during stress

• Structural Biology Integration:

  • Resolve membrane-associated conformational changes during stress

  • Identify stress-induced protein-protein interaction networks

  • Characterize post-translational modification patterns under stress conditions

• Translational Applications:

  • Investigate potential for engineering enhanced stress tolerance

  • Explore implications for biofuel production from Populus biomass

  • Develop molecular markers for stress-resistant varieties

These research directions represent a comprehensive approach to understanding the functional role of POPTRDRAFT_1070325 in stress response mechanisms, with potential applications in improving Populus resilience to environmental challenges .

How can I develop a comprehensive research program around POPTRDRAFT_1070325 structure-function relationships?

To develop a comprehensive research program investigating structure-function relationships of POPTRDRAFT_1070325, implement this strategic framework:

• Sequential Research Phases:

  • Phase 1: Structural Characterization (Years 1-2)

    • Resolve protein structure through integrated computational and experimental approaches

    • Map functional domains and critical residues

    • Determine membrane topology and interaction interfaces

  • Phase 2: Functional Dissection (Years 2-3)

    • Create domain deletion and point mutation libraries

    • Perform structure-guided mutagenesis of key residues

    • Assess functional consequences in heterologous systems

  • Phase 3: In Planta Validation (Years 3-5)

    • Generate transgenic Populus lines with modified POPTRDRAFT_1070325

    • Evaluate phenotypic consequences under various conditions

    • Perform multi-omics characterization of transgenic lines

• Integrated Technology Platform:

  Technique	Application	Expected Outcome
  Cryo-EM	High-resolution structure	Membrane topology, interaction interfaces
  MD Simulations	Dynamic behavior	Conformational changes, flexibility hotspots
  Hydrogen-deuterium exchange	Solvent accessibility	Domain organization, binding regions
  Site-directed mutagenesis	Structure-function studies	Critical residues for activity
  Phenomics	Whole-plant phenotyping	Physiological roles and impacts

• Collaborative Network Structure:

  • Core structural biology team

  • Plant molecular biology and genetics expertise

  • Bioinformatics and computational modeling support

  • Field testing and phenotyping capabilities

This comprehensive approach integrates cutting-edge technologies with classical genetic approaches to systematically dissect structure-function relationships of POPTRDRAFT_1070325, providing a roadmap for understanding this protein's role in Populus biology .

What are the most reliable resources for CASP-like protein research in Populus species?

For conducting high-quality research on CASP-like proteins in Populus species, the following resources provide reliable data and methodologies:

• Genomic and Proteomic Databases:

  • Populus Genome Portal (JGI Phytozome): Comprehensive genomic data and tools

  • PopGenIE: Populus-specific gene expression visualization and analysis tools

  • UniProt (Entry B9GHX8): Curated protein information and functional annotations

  • PLAZA Plant Comparative Genomics: Orthology information and synteny analysis

• Structural Databases and Tools:

  • Protein Data Bank (PDB): Repository of experimentally determined structures

  • CASP Resource Portal: Latest methods in protein structure prediction

  • AlphaFold DB: AI-predicted structures of proteins including plant proteins

  • ExPASy Tools: Suite of protein analysis tools including transmembrane prediction

• Experimental Protocols Sources:

  • Plant Methods Journal: Peer-reviewed protocols for plant molecular biology

  • Current Protocols in Plant Biology: Standardized, validated methodologies

  • Bio-protocol: Step-by-step protocols with troubleshooting guides

• Research Communities:

  • International Poplar Commission: Network of Populus researchers

  • Plant Membrane Protein Community: Specialized expertise in membrane proteins

  • CASP Community: Experts in protein structure prediction and validation

When conducting CASP-like protein research, implement systematic literature reviews incorporating both published and unpublished studies to ensure comprehensive coverage. Recent analysis shows that systematic reviews typically include a median of 14.5-15.5 primary studies, with unpublished studies representing a valuable but often underutilized resource .

How can I develop effective collaborations for interdisciplinary research on POPTRDRAFT_1070325?

To establish productive interdisciplinary collaborations for POPTRDRAFT_1070325 research, implement this strategic framework:

• Collaboration Design Matrix:

  Discipline	Expertise Needed	Mutual Benefit	Communication Strategy
  Structural Biology	Membrane protein structure determination	Access to novel protein family	Monthly virtual meetings, shared structural models
  Plant Physiology	In planta functional analysis	Molecular mechanistic insights	Quarterly progress reviews, shared field trials
  Computational Biology	Molecular dynamics, protein-protein interaction prediction	Experimental validation of predictions	Biweekly data sharing, joint model development
  Forestry/Bioenergy	Field-scale phenotyping, biomass characterization	Molecular markers for breeding	Annual workshops, shared germplasm collection

• Collaboration Initiation Protocol:

  • Develop clear research questions using PICOT framework

  • Create comprehensive proposals with explicit roles

  • Establish data sharing agreements early

  • Define publication and intellectual property policies

• Scientific Communication Standards:

  • Implement shared vocabulary and ontologies

  • Develop discipline-bridging visualizations

  • Create centralized data repositories

  • Schedule regular cross-disciplinary presentations

• Evaluation Metrics:

  • Define success indicators for each discipline

  • Establish timeline for deliverables

  • Implement periodic review processes

  • Document and address interdisciplinary challenges