Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_575900 (POPTRDRAFT_575900)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant POPTRDRAFT_575900

The recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_575900 (hereafter referred to by its accession identifier) is a bioengineered variant of a native protein in the black cottonwood (Populus trichocarpa), a model organism for studying vascular plant biology. This protein belongs to the CASP-like (CASPL) family, which is structurally and evolutionarily related to Casparian Strip Membrane Domain Proteins (CASPs) . CASPLs are four-transmembrane domain proteins implicated in forming plasma membrane scaffolds and modulating cell wall modifications .

Sequence and Biochemical Properties

PropertyDetails
AccessionPOPTRDRAFT_575900 (UniProt: B9IH36)
Expression RegionPartial sequence (aa 1–202)
Amino Acid SequenceMSYLGVGVSPGNVPVYHGTNSKVIDRRVRLAELVLRCVICCLGVLAAVLVGTDTQVKEIF...* (Full sequence in )
Purity>85% (SDS-PAGE)
SourceMammalian cell expression system

Role in Membrane Scaffolding

CASPLs, including POPTRDRAFT_575900, are hypothesized to form stable plasma membrane domains similar to CASPs. These scaffolds restrict lateral membrane diffusion and recruit enzymes (e.g., lignin peroxidases) for cell wall modifications . Key findings:

  • Membrane Domain Formation: CASPLs integrate into CASP membrane domains when ectopically expressed, suggesting shared structural roles .

  • Cell Wall Interaction: Potential role in lignin deposition or suberin formation, though direct evidence for POPTRDRAFT_575900 is lacking .

Stress Adaptation and Vascular Tissue Roles

  • Cold Tolerance: Orthologs like ClCASPL (watermelon) and AtCASPL4C1 (Arabidopsis) are cold-inducible and influence biomass accumulation and flowering time .

  • Hormone Responsiveness: CASP-like genes in rice and Arabidopsis contain abscisic acid, ethylene, and methyl jasmonate-responsive elements, suggesting roles in stress signaling .

Experimental Uses

ApplicationDetails
Functional StudiesInvestigating membrane domain dynamics, protein interactions, or enzymatic activity recruitment .
Structural AnalysesX-ray crystallography or cryo-EM to resolve transmembrane topology.
Hormone/Environmental StudiesTesting responsiveness to abiotic stresses (e.g., cold, drought) .

Classification and Subfamilies

CASPLs are divided into subfamilies (e.g., CASP-like-I to -V) based on conserved motifs and phylogenetic clustering . POPTRDRAFT_575900 likely belongs to a subfamily with structural motifs (e.g., Motif 1, 3, 4, 6, 8, 9) .

Cross-Kingdom Homologs

  • MARVEL Proteins: Found in stramenopiles, fungi, and animals, suggesting ancient evolutionary origins .

  • Divergence in Plants: CASPLs in Arabidopsis and rice exhibit distinct subfamily compositions, hinting at functional specialization .

Potential Research Directions

  1. Membrane Dynamics: Investigate POPTRDRAFT_575900’s ability to form diffusion barriers in heterologous systems.

  2. Stress Signaling: Explore its role in cold/drought responses using mutant or overexpression lines.

  3. Evolutionary Studies: Compare its sequence conservation with non-plant MARVEL homologs to trace functional divergence.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. We recommend contacting your local distributors for specific delivery timelines.
Please note that all our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its inclusion in the production process.
Synonyms
POPTRDRAFT_575900; CASP-like protein 2B1; PtCASPL2B1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Target Names
POPTRDRAFT_575900
Target Protein Sequence
MSYLGVGVSPGNVPVYHGTNSKVIDRRVRLAELVLRCVICCLGVLAAVLVGTDTQVKEIF SIQKKARFTDMKALVFLVAANGIAAAYSFVQGVRCVVGMVKGSVLFSKPLAWVIFSGDQM MAYLTMSAVAAAAQSSVFAKLGQPDLQWMKICTMYGKFCNQVGEGIASALLVSVSMVVLS CISAFSLFRLYGGNKGKDGARW
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is POPTRDRAFT_575900 and what is its function in Populus trichocarpa?

POPTRDRAFT_575900 is a CASP-like protein found in Populus trichocarpa (Western balsam poplar). Similar to other CASP (Casparian strip membrane domain proteins) family members, it is likely involved in the formation of Casparian strips in the endodermis, which are crucial barrier structures that control solute movement between roots and vascular tissues. Research approaches to determine its function typically include:

  • Expression pattern analysis using RT-PCR or RNA-Seq

  • Subcellular localization studies using fluorescent protein fusions

  • Phenotypic analysis of knockout/knockdown lines

  • Complementation studies in Arabidopsis casp mutants

Similar CASP-like proteins such as POPTRDRAFT_820327 have been characterized and shown to contain transmembrane domains typical of the CASP family, suggesting membrane localization and potential roles in barrier formation or cell wall organization .

How can I confirm the sequence integrity of recombinant POPTRDRAFT_575900?

When working with recombinant POPTRDRAFT_575900, sequence verification is essential to ensure experimental validity. The methodological approach includes:

  • PCR amplification of the coding sequence from cDNA

  • Sanger sequencing of the amplified product

  • Mass spectrometry analysis of the purified protein

  • Peptide mapping of tryptic digests

Based on similar CASP-like proteins from Populus trichocarpa, such as POPTRDRAFT_820327, you should expect a protein of approximately 180-190 amino acids . The sequencing results should be compared with the reference sequence in public databases. Any discrepancies might represent natural variations or potential cloning artifacts that could affect protein function.

What are the predicted structural features of POPTRDRAFT_575900?

As a CASP-like protein, POPTRDRAFT_575900 likely shares structural similarities with other members of this family. Based on analyses of similar proteins like POPTRDRAFT_820327, the predicted structural features include:

Structural FeaturePredictionAnalysis Method
Transmembrane domains4TMHMM Server
Signal peptideYes (N-terminal)SignalP
Conserved domainsCASP domainNCBI CDD
Secondary structurePredominantly α-helicalPsiPred
Molecular weight~20-22 kDaExPASy
Isoelectric point8.5-9.5ExPASy

These predictions should be experimentally validated through circular dichroism spectroscopy, limited proteolysis, and other structural biology techniques. Similar CASP-like proteins from Populus trichocarpa contain highly conserved transmembrane regions and specific amino acid residues critical for protein-protein interactions and membrane localization .

What expression systems are most effective for producing recombinant POPTRDRAFT_575900?

Based on experiences with similar CASP-like proteins, the following expression systems have demonstrated varying degrees of success:

Expression SystemAdvantagesLimitationsYield
E. coli (BL21)Quick, inexpensive, high yieldLacks post-translational modifications, inclusion body formation common5-10 mg/L
Pichia pastorisGood for membrane proteins, proper foldingLonger development time, glycosylation patterns differ from plants2-5 mg/L
Plant-based (N. benthamiana)Native post-translational modificationsLower yield, more complex extraction0.5-2 mg/L
Insect cells (Sf9)Complex protein folding, glycosylationExpensive, technical expertise required1-3 mg/L

When expressing POPTRDRAFT_575900 in E. coli, codon optimization is crucial as plant codon usage differs significantly from bacterial systems. For optimal expression in E. coli, the use of specialized strains like Rosetta(DE3) that supply rare tRNAs can improve yield and solubility. As noted with similar proteins, fusion tags (particularly His-tags) facilitate purification while maintaining protein function .

How can I troubleshoot low expression yields of recombinant POPTRDRAFT_575900?

When facing low expression yields of recombinant POPTRDRAFT_575900, implement the following systematic troubleshooting approach:

  • Sequence analysis and optimization:

    • Check for rare codons and optimize for the expression host

    • Examine GC content and mRNA secondary structures

    • Consider using fusion partners (MBP, SUMO, TrxA) to enhance solubility

  • Expression condition optimization:

    • Test multiple expression temperatures (16°C, 25°C, 30°C, 37°C)

    • Vary IPTG concentration (0.1 mM to 1 mM)

    • Implement auto-induction media systems

    • Test expression in different cell compartments (cytoplasmic vs. periplasmic)

  • Host strain selection:

    • BL21(DE3)pLysS for toxic proteins

    • C41/C43 for membrane proteins

    • Rosetta for rare codon optimization

    • SHuffle for disulfide bond formation

  • Protein stability enhancement:

    • Add protease inhibitors during extraction

    • Include stabilizing agents (glycerol, sucrose, specific ions)

    • Optimize pH and buffer composition

Similar membrane-associated proteins from Populus trichocarpa have shown improved expression when cultivated at lower temperatures (16-25°C) with extended induction times (16-24 hours), which reduces inclusion body formation and promotes proper folding .

What methods are most effective for studying POPTRDRAFT_575900 interactions with other proteins?

To investigate POPTRDRAFT_575900 protein interactions, several complementary approaches can be employed:

  • In vitro methods:

    • Pull-down assays using His-tagged POPTRDRAFT_575900

    • Surface plasmon resonance (SPR) for binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Crosslinking followed by mass spectrometry

  • In vivo methods:

    • Yeast two-hybrid screening

    • Split-GFP complementation assays

    • Bimolecular fluorescence complementation (BiFC)

    • Co-immunoprecipitation from plant tissue

  • Computational prediction:

    • Interactome database mining

    • Structural docking simulations

    • Co-expression network analysis

For membrane-associated proteins like CASP-family members, modified methods such as membrane yeast two-hybrid systems or proximity-dependent biotin identification (BioID) often yield more reliable results. When designing experiments to study POPTRDRAFT_575900 interactions, it's essential to include appropriate positive and negative controls and validate key interactions through multiple independent techniques .

How should I design experiments to study POPTRDRAFT_575900 function in Populus trichocarpa?

A comprehensive experimental design to study POPTRDRAFT_575900 function should include:

  • Expression profiling:

    • Quantitative RT-PCR across tissues, developmental stages, and stress conditions

    • RNA-seq analysis for global expression patterns

    • Promoter-reporter fusions to visualize spatial and temporal expression

  • Localization studies:

    • Generate C- and N-terminal fluorescent protein fusions

    • Perform immunolocalization with specific antibodies

    • Use subcellular fractionation followed by western blotting

  • Functional characterization:

    • Generate knockout/knockdown lines using CRISPR-Cas9 or RNAi

    • Perform complementation assays with wild-type or mutated versions

    • Test for altered phenotypes under various growth conditions

  • Biochemical analysis:

    • Assess protein-protein interactions using pull-down assays

    • Identify post-translational modifications via mass spectrometry

    • Determine membrane topology using protease protection assays

Each experiment should include appropriate controls: wild-type plants, empty vector transformants, and plants expressing unrelated proteins of similar size and localization. For knockout studies, multiple independent transformation lines should be analyzed to control for position effects and transformation-induced artifacts .

What controls are essential when studying POPTRDRAFT_575900 in vitro?

When conducting in vitro studies with recombinant POPTRDRAFT_575900, include these essential controls:

  • Protein quality controls:

    • Thermally denatured POPTRDRAFT_575900 (negative control)

    • Purification tag alone (to rule out tag-mediated effects)

    • Size exclusion chromatography to confirm monodispersity

    • Circular dichroism to verify proper folding

  • Activity assay controls:

    • Buffer-only reactions (negative control)

    • Well-characterized related protein with known activity (positive control)

    • Concentration gradients to establish dose-dependency

    • Time course experiments to establish reaction kinetics

  • Interaction study controls:

    • Non-specific protein of similar size and properties

    • Competition assays with unlabeled proteins

    • Mutated versions targeting predicted interaction sites

  • Stability and storage controls:

    • Fresh vs. stored protein comparison

    • Multiple freeze-thaw cycles assessment

    • Different buffer compositions evaluation

For membrane-associated proteins like CASP-family members, additional controls should include detergent-only samples and liposome-reconstitution efficiency measurements. All experiments should be performed with at least three technical replicates and two or more independent protein preparations to ensure reproducibility .

How can I develop an assay to measure POPTRDRAFT_575900 activity?

Developing a functional assay for POPTRDRAFT_575900 requires understanding its predicted molecular function. Based on knowledge of CASP-like proteins, consider these approaches:

  • Membrane association assays:

    • Liposome binding assays with fluorescently labeled protein

    • Sucrose gradient fractionation to assess membrane integration

    • Detergent resistance assays to evaluate membrane microdomain association

  • Protein complex formation assessment:

    • Native PAGE to identify higher-order complexes

    • Analytical ultracentrifugation to determine complex stoichiometry

    • Förster resonance energy transfer (FRET) to measure protein proximity

  • Barrier function evaluation:

    • Reconstitution into artificial membranes and permeability testing

    • Electrophysiological measurements in expression systems

    • Fluorescent tracer diffusion assays in transgenic plant lines

  • Lignin/suberin deposition measurement:

    • Histochemical staining for lignin/suberin in transgenic plants

    • Quantitative analysis of cell wall components

    • Atomic force microscopy to assess changes in cell wall properties

The assay development process should begin with pilot experiments to establish baseline measurements, followed by optimization of assay conditions (pH, temperature, buffer composition) and validation using known inhibitors or activators if available .

How should I analyze sequence conservation of POPTRDRAFT_575900 across different Populus species?

To analyze POPTRDRAFT_575900 sequence conservation across Populus species, employ the following methodological approach:

  • Sequence retrieval and alignment:

    • Collect homologous sequences using BLAST against genomic databases

    • Perform multiple sequence alignment using MUSCLE, MAFFT, or T-Coffee

    • Visualize alignments using Jalview or similar tools

  • Conservation analysis:

    • Calculate sequence identity and similarity percentages

    • Generate conservation scores using ConSurf or similar tools

    • Map conservation onto predicted structural models

  • Selection pressure analysis:

    • Calculate Ka/Ks ratios to identify positions under selection

    • Perform PAML analysis for site-specific selection

    • Use FUBAR or MEME to detect episodic selection

  • Phylogenetic analysis:

    • Construct phylogenetic trees using maximum likelihood methods

    • Perform bootstrap analysis (>1000 replicates) for confidence assessment

    • Compare gene trees with species trees to identify duplication events

Expected conservation patterns for CASP-like proteins include highly conserved transmembrane domains and more variable loop regions. The table below illustrates typical conservation patterns observed in CASP-family proteins:

Protein RegionExpected ConservationFunctional Implication
Transmembrane domainsHigh (>80% identity)Critical for membrane integration
N-terminal regionModerate (~60% identity)Species-specific regulation
C-terminal regionVariable (30-70% identity)Functional diversification
CASP domainVery high (>90% identity)Core functional element

Analysis should include outgroups from non-Populus species to provide evolutionary context and identify Populus-specific adaptations .

What statistical approaches are appropriate for analyzing POPTRDRAFT_575900 expression data?

When analyzing POPTRDRAFT_575900 expression data, apply these statistical approaches:

  • Preprocessing steps:

    • Normalization methods: RPKM/FPKM for RNA-seq, ΔCt for qPCR

    • Log transformation to achieve normal distribution

    • Outlier detection using boxplots or Cook's distance

    • Quality control metrics (RNA integrity, amplification efficiency)

  • Differential expression analysis:

    • For parametric data: t-test (two conditions) or ANOVA (multiple conditions)

    • For non-parametric data: Mann-Whitney U or Kruskal-Wallis tests

    • For RNA-seq: DESeq2, edgeR, or limma-voom packages

    • Multiple testing correction (Benjamini-Hochberg FDR)

  • Expression pattern analysis:

    • Hierarchical clustering to identify co-expressed genes

    • Principal component analysis for dimensional reduction

    • K-means clustering to identify expression modules

    • Time-series analysis for developmental studies

  • Functional interpretation:

    • Gene Ontology enrichment of co-expressed genes

    • Gene Set Enrichment Analysis (GSEA)

    • Network analysis using STRING or Cytoscape

    • Correlation with phenotypic or environmental data

What are the best storage conditions for maintaining recombinant POPTRDRAFT_575900 stability?

Optimal storage conditions for recombinant POPTRDRAFT_575900 should be empirically determined, but based on similar CASP-like proteins, the following guidelines are recommended:

  • Short-term storage (1-2 weeks):

    • Temperature: 4°C

    • Buffer composition: Tris or phosphate buffer (pH 7.5-8.0) with 150-300 mM NaCl

    • Additives: 5-10% glycerol, 1 mM reducing agent (DTT or β-mercaptoethanol)

    • Container: Low-binding microcentrifuge tubes

  • Medium-term storage (1-6 months):

    • Temperature: -20°C

    • Buffer additions: 20-50% glycerol or 6% trehalose

    • Aliquoting: Multiple small volumes to avoid freeze-thaw cycles

    • Additives: Protease inhibitor cocktail

  • Long-term storage (>6 months):

    • Temperature: -80°C or lyophilized state

    • Cryoprotectants: 50% glycerol or lyophilization with 6% trehalose

    • Oxygen exclusion: Seal under nitrogen or argon

    • Container: Cryovials with secure seals

For membrane-associated proteins like CASP-family members, stability can be significantly enhanced by:

  • Including 0.05-0.1% non-denaturing detergent (DDM or CHAPS)

  • Adding specific lipids that mimic the native membrane environment

  • Maintaining protein concentration between 0.5-2.0 mg/mL

Stability should be monitored using activity assays and analytical techniques (SEC, DLS) after various storage periods. As noted with similar proteins, repeated freeze-thaw cycles should be avoided, with working aliquots maintained at 4°C for up to one week .

What techniques are available for studying POPTRDRAFT_575900 localization in plant cells?

Several complementary techniques can be employed to study the subcellular localization of POPTRDRAFT_575900:

  • Fluorescent protein fusion approaches:

    • Transient expression in protoplasts or N. benthamiana leaves

    • Stable transformation in Arabidopsis or Populus

    • Considerations: N-terminal vs. C-terminal tags, linker optimization

    • Co-localization with established organelle markers

  • Immunolocalization techniques:

    • Generation of specific antibodies against POPTRDRAFT_575900

    • Immunogold labeling for transmission electron microscopy

    • Fluorescent immunohistochemistry for confocal microscopy

    • Verification of antibody specificity using knockout lines

  • Biochemical fractionation:

    • Differential centrifugation to separate cellular compartments

    • Density gradient separation of membrane types

    • Western blot analysis of fractions

    • Enzymatic assays to confirm fraction purity

  • Advanced microscopy methods:

    • Super-resolution microscopy (STORM, PALM)

    • Correlative light and electron microscopy (CLEM)

    • Fluorescence recovery after photobleaching (FRAP) for mobility studies

    • Single-particle tracking for dynamic localization

Each method has strengths and limitations, so combining multiple approaches provides the most reliable localization information. Controls should include known proteins with established localization patterns and validation using independent methods. For CASP-like proteins, careful sample preparation is essential to preserve membrane structures and prevent artificial relocalization during fixation or extraction .

How can I validate antibodies for POPTRDRAFT_575900 detection?

Validating antibodies for POPTRDRAFT_575900 detection requires a systematic approach:

  • Initial characterization:

    • Western blot against recombinant protein with concentration gradients

    • Peptide competition assay to confirm specificity

    • Cross-reactivity testing against related CASP-like proteins

    • Testing in different sample types (recombinant protein, plant extracts)

  • Specificity validation:

    • Testing in knockout/knockdown lines (negative control)

    • Testing in overexpression lines (positive control)

    • Pre-immune serum comparison

    • Western blot with tissue-specific expression correlation

  • Application-specific validation:

    • For Western blot: Optimizing primary/secondary antibody concentrations

    • For immunoprecipitation: Testing various lysis and binding conditions

    • For immunohistochemistry: Optimizing fixation and permeabilization

    • For ELISA: Determining linear range and limit of detection

  • Documentation and reporting:

    • Recording complete validation procedures

    • Reporting all positive and negative controls

    • Documenting optimal conditions for each application

    • Noting any cross-reactivity or limitations

A comprehensive validation matrix should be created, testing the antibody under various conditions and applications:

ApplicationOptimal DilutionBuffer CompositionIncubation ConditionsDetection Method
Western blot1:1000TBST + 5% milkOvernight at 4°CHRP-conjugated secondary
Immunofluorescence1:200PBS + 1% BSA2 hours at RTFluorescent secondary
Immunoprecipitation1:50IP buffer + 0.1% NP-404 hours at 4°CProtein A/G beads
ELISA1:500Carbonate buffer, pH 9.61 hour at 37°CColorimetric detection

For membrane proteins like CASP-family members, sample preparation that preserves native conformation is particularly important, as denaturation can affect epitope accessibility .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.