Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_752786 (POPTRDRAFT_752786)

Shipped with Ice Packs
In Stock

Description

Transmembrane Domain Organization

POPTRDRAFT_752786, consistent with other CASP family proteins, features a distinctive organization of transmembrane domains that enables its function in membrane scaffolding. The protein's structure likely includes:

  1. Four transmembrane segments that anchor the protein within the plasma membrane

  2. Short intracellular loops connecting these transmembrane domains

  3. Two extracellular loops that may be involved in protein-protein interactions

  4. Cytoplasmic N and C termini, with the C-terminus being relatively short

This structural arrangement is fundamental to the protein's presumed function in creating specialized membrane domains and facilitating cell wall modification processes in Populus trichocarpa.

Classification and Evolutionary Context

POPTRDRAFT_752786 belongs to the Casparian strip membrane proteins (CASP) family, specifically classified as a CASP-like (CASPL) protein . This classification places it within a broader evolutionary context that spans across plant species. The CASP and CASPL proteins form a large family found throughout the plant kingdom, from green algae to complex flowering plants, with POPTRDRAFT_752786 representing one member within the diverse Populus trichocarpa genome.

CASPLs show remarkable conservation across plant species, suggesting essential biological functions that have been maintained throughout plant evolution. Interestingly, CASP-like proteins share homology with the MARVEL protein family found outside the plant kingdom . This evolutionary relationship indicates ancient origins of these membrane-organizing proteins predating the divergence of major eukaryotic lineages.

Phylogenetic Position

The evolutionary relationship between POPTRDRAFT_752786 and other CASP/CASPL proteins can be contextualized within the broader classification of these proteins. Based on structural and sequence similarities, CASP-like proteins in plants can be categorized into several subgroups, with POPTRDRAFT_752786 representing one variant evolved specifically in woody perennial species. The conservation of key residues across these proteins suggests functional significance maintained through selective pressure during evolution.

Conserved Domains and Motifs

Domain/MotifPositionConservationPotential Function
Transmembrane Domain 147-67HighMembrane anchoring with conserved Arg
Transmembrane Domain 288-108ModerateMembrane spanning
Transmembrane Domain 3127-147HighMembrane anchoring with conserved Asp
Transmembrane Domain 4167-187ModerateMembrane spanning
MARVEL-like DomainSpans all TM domainsHighMembrane organization

The MARVEL-like domain, which spans the four transmembrane regions, is particularly significant as it connects CASP-like proteins to a broader family of membrane-organizing proteins found across diverse organisms . This conservation suggests fundamental roles in membrane biology that have been maintained throughout eukaryotic evolution.

Functional Implications Based on CASP Family Characteristics

While specific functions of POPTRDRAFT_752786 have not been directly characterized in the provided literature, its classification as a CASP-like protein allows for reasonable inferences about its potential roles based on the known functions of related proteins.

CASP proteins are primarily known for their involvement in forming the Casparian strip, a specialized cell wall modification in the endodermis of plant roots that creates a barrier to water and solute movement . The Casparian strip membrane domain (CSD) represents a stable membrane scaffold where CASP proteins show extremely low turnover. This domain is crucial for restricting the diffusion of other membrane proteins and lipids, effectively compartmentalizing the plasma membrane .

Membrane Scaffold Formation

Like other CASP proteins, POPTRDRAFT_752786 likely possesses the ability to form stable membrane domains. This property stems from the protein's four-transmembrane structure and conserved residues that facilitate protein-protein interactions within the membrane. When expressed, CASP proteins initially localize to the entire plasma membrane but subsequently concentrate in specific domains where they create a membrane scaffold .

Cell Wall Modification

Beyond membrane organization, CASP proteins direct the modification of adjacent cell walls through interactions with secreted enzymes such as peroxidases . This interaction facilitates lignin deposition, a critical process in forming structural barriers in plant tissues. Given its classification, POPTRDRAFT_752786 may participate in similar processes in Populus trichocarpa, potentially contributing to the formation of specialized cell wall structures in this woody species.

Potential Tissue-Specific Functions

While many characterized CASP proteins function primarily in root endodermis, the diversity of CASP-like proteins suggests varied tissue-specific roles. As a CASP-like protein in Populus trichocarpa, POPTRDRAFT_752786 may function in specialized tissues unique to woody perennials, such as:

  1. Secondary xylem formation during wood development

  2. Bark tissue organization

  3. Specialized barrier formation in aerial tissues

  4. Response to environmental stressors specific to trees

These potential functions highlight the importance of POPTRDRAFT_752786 in the biology of Populus trichocarpa as a model woody species.

Recombinant Expression and Applications

Recombinant expression of POPTRDRAFT_752786 provides valuable opportunities for studying this protein's structure and function. While the search results do not specifically address recombinant production of this particular protein, general approaches for full-length protein expression can be applied.

Expression Systems for Recombinant POPTRDRAFT_752786

The recombinant production of membrane proteins like POPTRDRAFT_752786 presents significant challenges due to their hydrophobic nature and requirement for proper membrane insertion. Several expression systems could be considered for its production:

Expression SystemAdvantagesDisadvantagesPotential Yield
E. coliCost-effective, rapid growthMay form inclusion bodiesLow-moderate
Yeast (P. pastoris)Post-translational modifications, membrane insertionLonger expression timeModerate
Insect cellsComplex folding, higher eukaryotic systemHigher cost, technical complexityModerate-high
Plant expression systemsNative-like environmentSlower growth, technical challengesVariable

For membrane proteins like POPTRDRAFT_752786, specialized approaches including the use of detergents, lipid nanodiscs, or amphipols may be necessary to maintain proper folding and stability during purification.

Research Applications

Recombinant POPTRDRAFT_752786 could serve numerous research applications:

  1. Structural studies: Purified protein could be used for crystallography or cryo-electron microscopy to determine the three-dimensional structure of this CASP-like protein.

  2. Protein-protein interaction studies: Identifying binding partners through pull-down assays or co-immunoprecipitation would elucidate the protein's role in cellular processes.

  3. Functional reconstitution: In vitro reconstitution in artificial membrane systems could demonstrate the protein's ability to form membrane domains.

  4. Cell wall modification studies: Investigating how the protein directs modifications of adjacent cell walls in Populus trichocarpa.

  5. Comparative studies: Examining functional differences between POPTRDRAFT_752786 and other CASP family members from different plant species.

These applications would significantly advance our understanding of CASP-like protein function in woody species and potentially reveal novel aspects of plant membrane biology.

POPTRDRAFT_752786 in Populus trichocarpa Biology

Populus trichocarpa (black cottonwood) serves as an important model organism for tree genetics and woody plant biology. As the first tree genome to be sequenced, it provides valuable insights into the genetic basis of tree-specific traits. POPTRDRAFT_752786, as a CASP-like protein in this species, likely plays specialized roles in the developmental processes unique to woody perennials.

Tissue Expression Patterns

While specific expression data for POPTRDRAFT_752786 is not directly provided in the search results, CASP-like proteins typically show tissue-specific expression patterns related to their functional roles. In Populus trichocarpa, POPTRDRAFT_752786 may be expressed in:

  1. Root tissues, particularly in the endodermis where Casparian strips form

  2. Vascular cambium, contributing to the formation of secondary vascular tissues

  3. Developing xylem, potentially involved in cell wall modifications during wood formation

  4. Specialized barrier tissues in stems or leaves

Understanding the expression pattern would provide valuable clues about the protein's biological role in this tree species.

Potential Roles in Wood Formation

As a CASP-like protein in a woody species, POPTRDRAFT_752786 may have unique functions related to wood development, a characteristic feature of trees like Populus trichocarpa. During wood formation, extensive cell wall modification occurs, including lignification - a process known to involve CASP proteins in other contexts . POPTRDRAFT_752786 could potentially facilitate the organized deposition of lignin and other cell wall components during xylem development, contributing to the structural properties of wood.

Comparative Analysis with Other CASP Family Proteins

Understanding POPTRDRAFT_752786 requires contextualizing it within the broader CASP protein family. The table below compares key features of this protein with other characterized CASP/CASPL proteins:

ProteinSpeciesSize (aa)Mass (kDa)Key FeaturesPrimary Function
POPTRDRAFT_752786Populus trichocarpa19321.346CASP-like protein 1F3Predicted membrane scaffold, cell wall modification
AtCASP1Arabidopsis thaliana~200~22Endodermis-specific, contains EL1 signatureCasparian strip formation
AtCASP-like proteinsArabidopsis thalianaVariableVariableDiverse tissue expressionVarious membrane organization roles
Green algae CASPLsVarious speciesVariableVariableAncient CASP homologsBasic membrane organization

This comparison reveals both the conserved features that define the CASP family and the potential specialization of POPTRDRAFT_752786 within Populus trichocarpa. While AtCASP1 and other well-characterized CASP proteins primarily function in Casparian strip formation in the root endodermis, POPTRDRAFT_752786 may serve adapted functions specific to the biology of poplar trees.

Conservation of Critical Domains

The search results indicate that certain domains are particularly well-conserved among CASP-like proteins. For instance, an arginine residue in TM1 and an aspartic acid in TM3 are present in the vast majority of CASPLs . These conserved residues likely play crucial roles in protein function, such as facilitating protein-protein interactions or maintaining proper protein folding. The conservation of these residues in POPTRDRAFT_752786 suggests functional significance maintained throughout evolution.

Methods for Studying POPTRDRAFT_752786

Investigating the functions and properties of POPTRDRAFT_752786 requires a multi-faceted approach combining molecular, cellular, and biochemical techniques. Based on methods used to study other CASP proteins, several approaches would be valuable:

Localization Studies

Fluorescent protein fusions could determine the subcellular localization of POPTRDRAFT_752786. By creating translational fusions with fluorescent reporters like GFP, researchers could observe where the protein localizes within Populus trichocarpa cells, potentially revealing specialized membrane domains similar to the Casparian strip membrane domain observed with other CASP proteins .

Mutagenesis Analysis

Site-directed mutagenesis of conserved residues would help identify amino acids critical for protein function. The search results indicate that in AtCASP1, mutating the conserved Asp residue in TM3 (D134H) prevented proper protein folding, while mutations in the second extracellular loop affected localization to varying degrees . Similar approaches could identify functional residues in POPTRDRAFT_752786.

Protein-Protein Interaction Studies

Co-immunoprecipitation, yeast two-hybrid assays, or proximity labeling approaches could identify proteins that interact with POPTRDRAFT_752786. Such studies would reveal potential binding partners involved in membrane organization or cell wall modification processes.

Functional Reconstitution

Purified recombinant POPTRDRAFT_752786 could be reconstituted into artificial membrane systems to study its intrinsic properties, such as the ability to form organized domains or exclude certain lipids and proteins from specific membrane regions.

Future Research Directions and Applications

Research on POPTRDRAFT_752786 and related CASP-like proteins offers several promising directions for future investigation:

Comparative Genomics

Expanding the analysis of CASP-like proteins across diverse plant species could reveal evolutionary patterns and functional specialization. Comparing POPTRDRAFT_752786 with homologs in other tree species might highlight adaptations specific to woody plants.

Biotechnological Applications

Understanding the function of POPTRDRAFT_752786 could have applications in tree biotechnology, particularly in modifying wood properties for industrial applications. If this protein influences lignification or other aspects of cell wall formation, it might represent a target for engineering trees with altered wood characteristics.

Stress Response Studies

Investigating the role of POPTRDRAFT_752786 in response to environmental stresses could reveal important aspects of tree adaptation. CASP proteins are involved in forming barrier structures, which may be modulated under stress conditions to enhance plant resilience.

Synthetic Biology Approaches

The membrane-organizing properties of CASP proteins make them interesting candidates for synthetic biology applications. Engineered versions of POPTRDRAFT_752786 could potentially be used to create novel membrane domains with specialized functions in both plant and non-plant systems.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
POPTRDRAFT_752786; CASP-like protein 1F3; PtCASPL1F3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-193
Protein Length
full length protein
Species
Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Target Names
POPTRDRAFT_752786
Target Protein Sequence
MASPQNTSQKRFFQANSPGGMPTASQSQRSRILAQITLRFLAIAFTVTAIPVMITAKEPV SLLGLAITPSYKQSSAMKFLLGVNATVFAFTALSMLFVWPLRRSGSKPINYFFLHLHDMV MTLLLISGCAAATAVGYLSQYGQPETYWSPICDIVKKFCHQMLISTVLSYLAFFCYLALN ILSVHKLMSRATE
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is POPTRDRAFT_752786 and what is its role in Populus trichocarpa?

POPTRDRAFT_752786 is a CASP-like protein found in Populus trichocarpa (Western balsam poplar), also known as PtCASPL1F3. CASP-like proteins are structurally related to Casparian Strip membrane domain proteins, which are typically involved in forming diffusion barriers in plant tissues. In P. trichocarpa, this protein likely plays a role in cell wall organization and potentially in symbiotic relationships with mycorrhizal fungi. The protein consists of 193 amino acids and contains transmembrane domains characteristic of CASP family proteins .

How is recombinant POPTRDRAFT_752786 typically produced for research applications?

Recombinant POPTRDRAFT_752786 is typically produced in E. coli expression systems with an N-terminal His-tag for purification purposes. The full-length protein (amino acids 1-193) is expressed and then purified using affinity chromatography, taking advantage of the His-tag. The purified protein is commonly supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE. For research applications, it's recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, adding 5-50% glycerol for long-term storage at -20°C/-80°C .

What are the optimal storage and handling conditions for recombinant POPTRDRAFT_752786?

To maintain the structural integrity and activity of recombinant POPTRDRAFT_752786, follow these research-validated protocols:

  • Upon receipt, briefly centrifuge the vial to bring contents to the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is standard) to prevent freeze-thaw damage

  • Aliquot the protein solution to minimize freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • Store long-term aliquots at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as they can lead to protein denaturation and loss of function

The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during lyophilization and reconstitution .

How can I verify the purity and integrity of recombinant POPTRDRAFT_752786 before using it in experiments?

To ensure experimental reproducibility, validate your recombinant POPTRDRAFT_752786 preparation through:

  • SDS-PAGE analysis: Run the protein on a 10-15% gel to confirm the expected molecular weight (~21 kDa plus His-tag) and assess purity (should be >90%)

  • Western blotting: Use anti-His antibodies to confirm the presence of the His-tagged protein

  • Mass spectrometry: For precise molecular weight determination and to verify the complete amino acid sequence

  • Circular dichroism (CD): To evaluate proper protein folding and secondary structure

  • Size exclusion chromatography: To assess aggregation state and homogeneity

Commercial preparations typically undergo quality control with SDS-PAGE to ensure >90% purity, but additional validation is recommended for critical experiments to confirm structural integrity after reconstitution .

What methodological approaches can be used to study the interaction of POPTRDRAFT_752786 with other proteins?

To investigate protein-protein interactions involving POPTRDRAFT_752786, consider these methodological approaches:

  • Co-immunoprecipitation (Co-IP): Using anti-His antibodies to pull down POPTRDRAFT_752786 and identify interacting partners by mass spectrometry

  • Yeast two-hybrid (Y2H) screening: For identifying potential binding partners from a Populus trichocarpa cDNA library

  • Bimolecular fluorescence complementation (BiFC): To visualize interactions in planta by fusing protein fragments to POPTRDRAFT_752786 and potential interactors

  • Surface plasmon resonance (SPR): For quantitative measurement of binding kinetics and affinities

  • Protein pull-down assays: Using the His-tagged POPTRDRAFT_752786 as bait with plant extracts

  • Isothermal titration calorimetry (ITC): For thermodynamic characterization of binding interactions

When designing these experiments, it's important to consider the transmembrane nature of CASP-like proteins, which may require detergent-based buffers or membrane mimetics to maintain proper folding and function .

How is POPTRDRAFT_752786 expression regulated in Populus trichocarpa?

While specific expression data for POPTRDRAFT_752786 is limited in the provided search results, research on other Populus trichocarpa genes indicates complex regulation patterns, particularly during symbiotic interactions. Similar to other plant proteins involved in symbiosis, POPTRDRAFT_752786 expression is likely regulated by:

  • Developmental cues in different root tissues

  • Environmental factors, particularly nutrient availability

  • Presence of symbiotic partners like ectomycorrhizal fungi

For example, other P. trichocarpa genes show dramatic expression changes during interaction with Laccaria bicolor, with some genes being upregulated more than 10,000-fold under specific conditions. Quantitative RT-PCR analysis would be an appropriate method to determine POPTRDRAFT_752786 expression patterns under different conditions, with RNA-seq providing a more comprehensive view of expression in the context of the whole transcriptome .

What techniques are most effective for studying POPTRDRAFT_752786 expression in different tissues?

To effectively study POPTRDRAFT_752786 expression across Populus tissues, researchers should consider:

  • RNA sequencing (RNA-seq): For comprehensive transcriptome-wide analysis and quantification of expression levels across different tissues or conditions

  • Quantitative RT-PCR: For targeted validation of expression patterns with high sensitivity (shown to correlate significantly with RNA-seq data in Populus studies)

  • In situ hybridization: To localize mRNA expression to specific cell types within tissues

  • Promoter-reporter fusion assays: Using the POPTRDRAFT_752786 promoter fused to reporters like GFP or GUS to visualize expression patterns in transgenic poplar

  • Laser capture microdissection: Combined with qRT-PCR or RNA-seq for cell-type specific expression analysis

When analyzing expression data, it's important to normalize appropriately using stable reference genes validated for Populus tissues and to compare expression patterns with phylogenetically related CASP-like proteins to identify functional relationships .

How does symbiotic association with mycorrhizal fungi affect POPTRDRAFT_752786 expression?

Based on studies of P. trichocarpa's interaction with the ectomycorrhizal fungus Laccaria bicolor, many plant proteins show significant regulation during symbiosis. While specific data for POPTRDRAFT_752786 isn't provided, the pattern observed with other P. trichocarpa small secreted proteins (SSPs) suggests that:

  • SSPs can be significantly upregulated during mycorrhizal symbiosis

  • Some P. trichocarpa SSPs can enter fungal hyphae and affect hyphal growth and morphology

  • Expression patterns may differ between strong ECM host plants (like P. trichocarpa) and poor ECM host plants (like P. deltoides)

To study POPTRDRAFT_752786 regulation during symbiosis, researchers should establish controlled mycorrhizal colonization experiments and analyze gene expression at different stages of the interaction using RNA-seq or qRT-PCR. Comparison between different Populus species with varying mycorrhizal compatibility would provide insights into the protein's role in symbiotic establishment .

What structural features of POPTRDRAFT_752786 are important for its function?

POPTRDRAFT_752786, as a CASP-like protein, likely contains several key structural features important for its function:

  • Transmembrane domains: The amino acid sequence indicates multiple transmembrane regions, characteristic of CASP family proteins

  • Signal peptide: The N-terminal portion likely contains a signal peptide directing the protein to the cell membrane

  • Conserved domains: Specific protein domains may be involved in protein-protein interactions or membrane localization

Computational analysis of the amino acid sequence using tools like TMHMM (transmembrane prediction), SignalP (signal peptide prediction), and comparison with other characterized CASP proteins can help identify these features. Experimental approaches like site-directed mutagenesis of specific residues followed by functional assays would help validate the importance of these structural elements .

How can I determine if POPTRDRAFT_752786 interacts with fungal proteins during mycorrhizal symbiosis?

To investigate potential interactions between POPTRDRAFT_752786 and fungal proteins during mycorrhizal symbiosis, consider this methodological workflow:

  • Fluorescent labeling experiments: Tag POPTRDRAFT_752786 with FITC or HA and test its ability to enter fungal hyphae (similar to experiments conducted with other P. trichocarpa SSPs)

  • Localization studies: If the protein enters fungal cells, determine its subcellular localization (e.g., nucleus, cytoplasm)

  • Protein scrambling experiments: Create versions with scrambled amino acid sequences to test if specific sequence motifs are required for fungal entry

  • Co-immunoprecipitation with crosslinking: To capture transient interactions between the plant protein and fungal targets

  • Yeast two-hybrid screening: Using POPTRDRAFT_752786 as bait against a cDNA library from Laccaria bicolor

  • Functional assays: Measure the effect of purified recombinant POPTRDRAFT_752786 on hyphal growth and morphology

Research with other P. trichocarpa SSPs has shown that some can enter L. bicolor hyphae, localize to the nucleus, and affect hyphal growth, suggesting a potential effector-like function. Similar approaches could reveal whether POPTRDRAFT_752786 has comparable capabilities .

What pathways and biological processes is POPTRDRAFT_752786 potentially involved in?

Based on its classification as a CASP-like protein and evidence from related proteins, POPTRDRAFT_752786 is potentially involved in:

  • Cell wall organization: CASP proteins typically function in forming diffusion barriers in plant tissues

  • Nutrient transport regulation: Possibly controlling movement of minerals and water across cell barriers

  • Symbiotic interfaces: Potentially functioning at the interface between plant and fungal cells during mycorrhizal symbiosis

  • Root development: CASP proteins often play roles in specialized root structures

While specific pathway information for POPTRDRAFT_752786 is not directly mentioned in the search results, studies of P. trichocarpa's interaction with ectomycorrhizal fungi suggest potential roles in symbiotic processes. Transcriptomic studies combined with GO (Gene Ontology) enrichment analysis would help identify the biological processes associated with POPTRDRAFT_752786 expression .

How does POPTRDRAFT_752786 compare to similar proteins in other plant species?

A comparative analysis of POPTRDRAFT_752786 with related proteins should consider:

  • Phylogenetic relationships: Construct phylogenetic trees with CASP-like proteins from diverse plant species to determine evolutionary relationships

  • Sequence conservation: Identify highly conserved motifs across species that may indicate functional importance

  • Species-specific adaptations: Determine if POPTRDRAFT_752786 contains unique features specific to Populus or woody perennials

The search results indicate that some P. trichocarpa SSPs appear to be specific to Populus (without homologs in other examined species), while others have homologs only in closely related plant genera. A comparison between P. trichocarpa (strong ECM host) and P. deltoides (poor ECM host) showed that some SSPs present in P. trichocarpa were missing or truncated in P. deltoides, suggesting potential importance in mycorrhizal compatibility. Similar comparative analysis for POPTRDRAFT_752786 would provide insights into its evolutionary and functional significance .

Are there significant differences in POPTRDRAFT_752786 between Populus trichocarpa and other Populus species?

Research comparing different Populus species has revealed important genetic differences that may affect protein function and symbiotic capabilities:

  • Some P. trichocarpa small secreted proteins are missing or truncated in P. deltoides accessions

  • These differences correlate with the observation that P. trichocarpa is a strong ectomycorrhizal (ECM) host while P. deltoides is a poor ECM host

To determine if similar differences exist for POPTRDRAFT_752786:

  • Compare the sequence between P. trichocarpa accessions (Nisqually-1 and 93-960) and P. deltoides accessions (ILL-101 and D124)

  • Analyze the promoter regions for differences that might affect expression patterns

  • Conduct functional complementation studies to determine if differences affect protein function

Such comparative analysis could provide insights into whether POPTRDRAFT_752786 contributes to the differential mycorrhizal hosting capabilities observed between Populus species .

How do expression patterns of POPTRDRAFT_752786 compare across different Populus genotypes under varying environmental conditions?

While specific POPTRDRAFT_752786 expression data across genotypes isn't provided, research on other P. trichocarpa genes reveals significant variation in expression patterns between species and under different conditions:

Populus GenotypeLow Phosphate Response PatternExample Genes
P. trichocarpa>10,000-fold upregulationPtPT9, PtPT11
P. trichocarpa~1,000-fold upregulationPtPT12
P. trichocarpa~100-fold upregulationPtPT1, PtPT3
P. trichocarpa~2-fold downregulationPtPT5, PtPT6
P. deltoides>100-fold upregulationHomologs of PtPT3, PtPT5, PtPT6
Hybrid>100,000-fold upregulationHomologs of PtPT9, PtPT11

To study POPTRDRAFT_752786 expression patterns:

  • Design qRT-PCR primers specific to POPTRDRAFT_752786

  • Compare expression across different Populus genotypes (P. trichocarpa, P. deltoides, hybrids)

  • Test under various conditions (nutrient availability, mycorrhizal colonization, drought stress)

  • Validate findings with RNA-seq for genome-wide context

Understanding these expression patterns would provide insights into the protein's potential roles and regulation mechanisms across Populus species .

How can CRISPR-Cas9 gene editing be used to study POPTRDRAFT_752786 function in Populus trichocarpa?

A comprehensive CRISPR-Cas9 based strategy to study POPTRDRAFT_752786 function would include:

  • Gene knockout: Design sgRNAs targeting unique regions of POPTRDRAFT_752786 to create null mutants

  • Domain-specific mutations: Create targeted modifications to specific functional domains rather than complete knockouts

  • Promoter editing: Modify the native promoter to alter expression patterns

  • Tagging: Insert reporter genes (GFP, mCherry) in-frame to study subcellular localization

  • Multiplex editing: Target multiple CASP-like family members simultaneously to address functional redundancy

The transformation protocol should be optimized for Populus, typically using Agrobacterium-mediated transformation of stem segments or leaf discs, followed by callus induction and plant regeneration. Phenotypic analysis should focus on:

  • Root development and architecture

  • Casparian strip formation

  • Nutrient uptake efficiency

  • Mycorrhizal colonization rates

  • Transcriptomic changes in response to symbiotic fungi

This approach would provide definitive evidence of POPTRDRAFT_752786's functional role in Populus development and symbiotic interactions .

What approaches can resolve contradictory data about POPTRDRAFT_752786 localization and function?

When faced with contradictory data about POPTRDRAFT_752786 localization or function, implement this systematic troubleshooting framework:

  • Methodological validation:

    • Compare protein localization using multiple tagging approaches (N-terminal vs. C-terminal tags)

    • Verify tag position doesn't interfere with trafficking signals

    • Use both transient and stable transformation systems

  • Context-dependent analysis:

    • Test localization under varying developmental stages

    • Examine effects of environmental conditions (nutrient availability, stress)

    • Compare results in different genetic backgrounds

  • Resolution strategies:

    • Super-resolution microscopy for precise subcellular localization

    • Subcellular fractionation combined with immunoblotting

    • Time-course studies to capture dynamic relocalization

    • Simultaneous visualization of multiple cellular compartments

  • Functional validation:

    • Complement knockout lines with wild-type and mutated versions

    • Perform domain swapping with related proteins

    • Use inducible expression systems to control timing of expression

This systematic approach would help resolve contradictory findings and provide a more complete understanding of POPTRDRAFT_752786's dynamic functions in different contexts .

How can high-throughput sequencing approaches be used to identify genome-wide interactions of POPTRDRAFT_752786?

To identify genome-wide interactions and regulatory networks involving POPTRDRAFT_752786, implement these advanced sequencing approaches:

  • ChIP-seq (if DNA-binding activity is suspected):

    • Create transgenic Populus expressing tagged POPTRDRAFT_752786

    • Perform chromatin immunoprecipitation followed by sequencing

    • Identify potential DNA binding sites and regulated genes

  • RNA-seq comparative analysis:

    • Compare transcriptomes of wild-type and POPTRDRAFT_752786 knockout/overexpression lines

    • Identify differentially expressed genes in various tissues and conditions

    • Construct co-expression networks to identify functionally related genes

  • Ribosome profiling:

    • Assess translational impacts of POPTRDRAFT_752786 manipulation

    • Identify changes in ribosome occupancy on mRNAs

  • Proximity-dependent biotin labeling (BioID or TurboID):

    • Fuse POPTRDRAFT_752786 with a biotin ligase

    • Identify proximal proteins in living cells

    • Map the protein interaction network

  • ATAC-seq:

    • Assess chromatin accessibility changes in response to POPTRDRAFT_752786 manipulation

    • Identify potential regulatory regions affected

These approaches would provide a comprehensive understanding of POPTRDRAFT_752786's role in cellular processes and regulatory networks, moving beyond single-gene studies to system-level insights .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.