Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_818956 (POPTRDRAFT_818956)

Shipped with Ice Packs
In Stock

Description

Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_818956 (POPTRDRAFT_818956): Overview

The Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_818956 (Uniprot ID: B9HD38) is a synthetic version of a transmembrane protein native to Populus trichocarpa (Western balsam poplar). It belongs to the CASP-like (CASPL) protein family, which is evolutionarily conserved across land plants and green algae . These proteins are structurally related to the MARVEL protein family and are implicated in forming plasma membrane scaffolds, potentially influencing cell wall modifications and stress responses .

Role in Membrane Scaffolding

CASPL proteins, including POPTRDRAFT_818956, share structural homology with CASPs, which form the Casparian strip membrane domain (CSD) in plant roots. These domains act as diffusion barriers and coordinate lignin polymerization for Casparian strip formation . While POPTRDRAFT_818956 has not been directly studied, its conservation with CASPs suggests potential roles in:

  • Plasma membrane organization: Restricting lipids/proteins to specific domains.

  • Cell wall modification: Interacting with peroxidases for lignin deposition .

Evolutionary Context

CASPL proteins are present in all major land plant lineages but absent in Physcomitrella patens and Selaginella moellendorffii, which lack Casparian strips . This implies a link between CASPL evolution and vascular tissue specialization.

Research Gaps and Future Directions

While POPTRDRAFT_818956’s homology to CASPs is established, direct experimental validation of its functions remains limited. Prioritized areas include:

  1. Localizing its expression: Are POPTRDRAFT_818956 transcripts enriched in specific tissues (e.g., endodermis, vascular cambium)?

  2. Membrane dynamics: Does it form stable scaffolds or transient domains?

  3. Stress responses: Does it modulate cold tolerance or drought resistance, as seen in other CASPLs ?

References

  1. Colorectal Research. ELISA Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_818956. Link .

  2. Roppolo et al. (2014). Functional and Evolutionary Analysis of the CASPARIAN STRIP MEMBRANE DOMAIN PROTEINS. PMC .

  3. Creative BioMart. Recombinant Full Length Populus Trichocarpa Casp-Like Protein POPTRDRAFT_818956. Link .

  4. Zhao et al. (2015). A Casparian strip domain-like gene, CASPL, negatively alters Arabidopsis cold tolerance. PMC .

  5. Cusabio. Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_824792. Link .

  6. Creative BioMart. poptrdraft_818956. Link .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
POPTRDRAFT_818956; CASP-like protein 2B2; PtCASPL2B2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Target Names
POPTRDRAFT_818956
Target Protein Sequence
MSYLGVGVSPGNVPVYHGMNLKVIDRRVRLAELVLRCVICALGVLAAVLVGTDTQVKEIF SIQKKARFTDMKALVFLVVANGIAAAYSLVQGVRCVVGMVKGSVLFSKPLAWVIFSGDQM MAYLTLSAVAAAVQSASFAKLGQPDLQWMKICNMYGKFCNQVGEGIASALLVSVSMVVLS CISSFSLFRLYGGNKGKDGARW
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of CASP-like proteins in Populus trichocarpa and how do they compare to other plant species?

CASP-like proteins in Populus trichocarpa are four-transmembrane span proteins that share structural similarities with CASPARIAN STRIP MEMBRANE DOMAIN PROTEINS (CASPs). Analysis of related CASP-like proteins indicates they typically contain approximately 202 amino acid residues in their full-length form . These proteins feature two extracellular loops (EL1 and EL2), with conservation patterns primarily in EL2 across different plant species. EL1 shows poor conservation even within CASPL subgroups, while certain CASPs contain a highly conserved nine-residue stretch in EL1 found specifically in spermatophytes .

The transmembrane domains, particularly TM3, contain critically conserved residues such as an Asp residue that appears essential for correct protein folding. Mutagenesis studies of this conserved Asp residue (e.g., AtCASP1 D134H) resulted in no fluorescence-visible lines, suggesting its crucial importance to protein integrity .

Methodology: For structural characterization, researchers should employ multiple sequence alignment between known CASP proteins and candidate CASP-like proteins, followed by transmembrane domain prediction and conservation analysis across various plant species. Domain-swapping experiments can help determine functional regions.

What expression systems are most suitable for recombinant production of Populus trichocarpa CASP-like proteins?

While the optimal expression system specifically for POPTRDRAFT_818956 has not been definitively established in the available literature, related CASP-like protein production suggests several viable approaches:

Expression SystemAdvantagesLimitationsTag Compatibility
E. coliHigh yield, cost-effectiveMay have folding issues with membrane proteinsHis, GST, MBP
Insect cellsBetter for membrane proteinsMore expensive, lower yieldHis, FLAG, HA
Plant expression systemsNative folding environmentTime-consumingGFP, His
Cell-free systemsRapid productionLimited scale-upMultiple tag options

Methodology: Start with small-scale expression trials across different systems before optimization. For membrane proteins like CASPs, consider detergent screening to identify optimal solubilization conditions. The tag selection should be determined during the production process based on protein properties and experimental requirements, as practiced with similar CASP-like proteins .

What are the optimal storage conditions for maintaining stability of recombinant CASP-like proteins from Populus trichocarpa?

Based on validated protocols for similar CASP-like proteins from Populus trichocarpa, the following storage conditions are recommended:

  • Primary storage: -20°C for regular use or -80°C for extended storage periods

  • Buffer composition: Tris-based buffer supplemented with 50% glycerol, specifically optimized for protein stability

  • Working conditions: Aliquot preparation is crucial; store working aliquots at 4°C for a maximum of one week

  • Handling considerations: Avoid repeated freeze-thaw cycles as they significantly reduce protein functionality

Methodology: To validate storage stability, researchers should conduct time-course activity assays at different temperature conditions, using techniques such as circular dichroism or fluorescence spectroscopy to monitor structural integrity. For membrane proteins like CASPs, detergent stability in storage buffers should be periodically assessed.

How can researchers investigate the membrane domain formation properties of CASP-like proteins?

CASP-like proteins typically form membrane domains with scaffold-like properties. To investigate these characteristics:

  • Fluorescent protein tagging: Express the CASP-like protein fused with fluorescent markers in appropriate cell types to visualize domain formation. Comparison with known CASPs (such as CASP1-mCherry) provides valuable reference data .

  • Mutation analysis: Create targeted mutations in transmembrane domains and extracellular loops to identify crucial residues for domain formation. Note that previous research has shown that while EL1 deletion may not affect scaffold formation, certain residues in TM3 (particularly conserved Asp residues) are essential for proper folding .

  • Protein-protein interaction studies: Use techniques such as co-immunoprecipitation, FRET, or split-GFP assays to investigate interactions with other membrane components.

  • Membrane diffusion barrier assessment: Evaluate the ability of the CASP-like protein to establish membrane diffusion barriers using fluorescent lipid diffusion experiments or protein mobility assays .

Methodology: Begin with localization studies in heterologous systems, followed by more sophisticated biophysical analyses. For crucial experiments, consider using both N- and C-terminal tags to minimize interference with protein function.

What methodological approaches can be used to investigate interactions between CASP-like proteins and lignin polymerization machinery?

CASP-like proteins are involved in directing cell wall modifications through interactions with the lignin polymerization machinery. The following approaches can be used to study these interactions:

  • Protein-peroxidase interaction studies: Employ co-immunoprecipitation, yeast two-hybrid, or split-GFP assays to detect direct interactions between CASP-like proteins and peroxidases involved in lignin formation .

  • Ectopic expression systems: Express the CASP-like protein in tissues where it's not normally found to observe interactions with peroxidases outside the native domain, which can help separate membrane scaffold formation from cell wall modification functions .

  • Domain deletion studies: Create constructs with specific domains removed to determine which regions are necessary for interaction with the lignin polymerization machinery.

  • Lignin deposition analysis: Use histochemical staining, fluorescence microscopy, or mass spectrometry to quantify and characterize lignin deposition in tissues expressing wild-type versus mutant CASP-like proteins.

Methodology: It's important to note that the two CASP activities—membrane scaffold formation and cell wall modification direction—can be uncoupled experimentally, as formation of the CASP domain is independent of lignin deposition, and CASP-peroxidase interactions can occur outside the Casparian strip membrane domain when CASPs are ectopically expressed .

What is the evolutionary relationship between CASP-like proteins in Populus trichocarpa and related proteins in other organisms?

CASP-like (CASPL) proteins exist across a broad evolutionary spectrum:

  • Plant kingdom distribution: CASPLs have been found in all major divisions of land plants as well as in green algae, indicating ancient evolutionary origins .

  • Relationship to MARVEL proteins: Beyond the plant kingdom, CASPL homologs have been identified as members of the MARVEL protein family, suggesting a deeply conserved functional role in membrane organization across diverse organisms .

  • Populus-specific considerations: Within the Populus genus, evolutionary analysis should account for its recent whole-genome duplication, which likely created paralogous CASP-like genes with potential functional divergence.

Methodology: Conduct comprehensive phylogenetic analyses using maximum likelihood or Bayesian approaches with sequences from diverse plant species, focusing on transmembrane domain conservation. Integration with synteny analysis can reveal gene duplication patterns specific to Populus.

How can recombination mapping approaches enhance our understanding of CASP-like gene evolution in Populus trichocarpa?

High-resolution recombination mapping provides valuable insights into evolutionary dynamics of gene families:

  • Identification of selection pressure: Regions with CASP-like genes can be analyzed for recombination hotspots or coldspots, which may indicate selection patterns affecting these genes.

  • Sex-biased recombination: Recent research in Populus trichocarpa has demonstrated sex-biased recombination rates across 8 out of 19 chromosomes, with male-biased regions showing lower gene density and GC content . This sex-biased recombination could influence the evolution of CASP-like genes differently in male and female Populus trees.

  • Genomic context analysis: Recombination mapping reveals associations between genomic features and recombination rates. In Populus trichocarpa, cross-over events were positively associated with gene density and negatively associated with GC content and long-terminal repeats .

Methodology: Utilize dense genetic mapping techniques combined with whole-genome resequencing of full-sib families to construct high-resolution recombination maps. For Populus trichocarpa, approaches using biallelic SNPs/INDELs and pedigree information have successfully identified thousands of cross-over events, enabling fine-scale analysis of recombination patterns .

How can CRISPR-Cas9 genome editing be optimized for functional genomics studies of CASP-like proteins in Populus trichocarpa?

CRISPR-Cas9 genome editing of CASP-like genes in Populus trichocarpa requires specific considerations:

  • Guide RNA design strategy:

    • Target conserved regions in transmembrane domains, especially TM3 which contains functionally critical residues

    • Design multiple gRNAs to increase editing efficiency

    • Avoid regions with high GC content which are common in CASP genes

  • Delivery method optimization:

    • Agrobacterium-mediated transformation is most effective for Populus

    • Embryogenic callus or stems of young plants provide the best starting material

    • Optimize regeneration protocols specifically for the Populus trichocarpa genotype being edited

  • Phenotyping considerations:

    • Examine effects on Casparian strip formation using fluorescent dyes

    • Evaluate cell wall modifications using lignin-specific stains

    • Monitor membrane domain integrity using fluorescently tagged membrane proteins

Methodology: Employ a hierarchical phenotyping approach, starting with cellular-level observations of membrane integrity and progressing to whole-plant physiological assessments. Complementation studies with wild-type genes can confirm the specificity of observed phenotypes.

What are the methodological considerations for investigating CASP-like protein function in the context of abiotic stress responses in Populus?

CASP-like proteins may play crucial roles in stress adaptation, particularly through their effects on membrane integrity and cell wall modification:

  • Stress treatment design:

    • Apply controlled drought, salinity, or temperature stress treatments

    • Consider both acute and chronic stress regimes

    • Include recovery phases to assess resilience mechanisms

  • Gene expression analysis:

    • Use RT-qPCR to quantify expression changes of specific CASP-like genes

    • RNA-seq provides broader context of pathway regulation

    • Consider tissue-specific expression patterns (roots vs. stems vs. leaves)

  • Functional assessment approaches:

    • Measure membrane integrity under stress conditions using electrolyte leakage assays

    • Analyze xylem hydraulic conductivity in transgenic lines with modified CASP-like expression

    • Examine changes in cell wall composition using biochemical and microscopic methods

  • Integration with population-level data:

    • Correlate CASP-like allelic variation with adaptation to different environments

    • Consider ecotypic variation in Populus trichocarpa spanning environmental gradients

Methodology: Combine physiological, molecular, and genetic approaches to build a comprehensive understanding of how CASP-like proteins contribute to stress responses. Transgenic approaches (both overexpression and knockdown) should be evaluated across multiple independent lines to account for positional effects.

What advanced imaging techniques can effectively visualize the subcellular localization and dynamics of CASP-like proteins?

For studying the unique membrane localization patterns of CASP-like proteins:

  • Super-resolution microscopy approaches:

    • STED (Stimulated Emission Depletion) microscopy achieves resolution below the diffraction limit

    • PALM/STORM techniques enable single-molecule localization precision

    • SIM (Structured Illumination Microscopy) provides 2x standard resolution with less photodamage

  • Live-cell imaging strategies:

    • Photoconvertible fluorescent proteins allow pulse-chase experiments tracking protein movement

    • FRAP (Fluorescence Recovery After Photobleaching) quantifies protein mobility within membranes

    • TIRF microscopy enables visualization of membrane-proximal events with high contrast

  • Multi-channel co-localization:

    • Combine CASP-like protein labeling with markers for different membrane domains

    • Use organelle-specific markers to track localization during protein trafficking

    • Implement precise quantitative co-localization analysis methods

Methodology: When designing imaging experiments, consider that CASP proteins show an initially broad plasma membrane localization before becoming restricted to specific membrane domains . Time-course imaging is therefore essential to capture the complete dynamics of localization.

How can researchers effectively study the transmembrane topology and membrane integration of CASP-like proteins?

Understanding transmembrane topology is crucial for CASP-like protein functional analysis:

  • Biochemical approaches:

    • Protease protection assays to determine cytoplasmic vs. extracellular domains

    • Selective permeabilization combined with epitope tagging at different positions

    • Glycosylation site mapping to identify lumenal/extracellular domains

  • Computational prediction integration:

    • Compare results from multiple prediction algorithms (TMHMM, Phobius, TOPCONS)

    • Use evolutionary conservation patterns to refine structural models

    • Integrate hydrophobicity analysis with sequence-based predictions

  • Experimental topology validation:

    • Split-GFP complementation with fragments expressed in different cellular compartments

    • Cysteine accessibility methods to identify exposed residues

    • Crosslinking studies to identify proximity relationships between domains

Methodology: Begin with computational predictions, followed by experimental validation focusing on key boundary regions between transmembrane segments and loops. For CASP-like proteins, special attention should be paid to the second extracellular loop (EL2), which shows higher conservation among CASPLs and may have functional significance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.