The Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_820327 is a bioengineered version of a native protein identified in Populus trichocarpa (Western balsam poplar). It belongs to the CASP-like (CASPL) family, homologous to Casparian strip membrane domain proteins (CASPs) that mediate subcellular membrane organization and cell wall modifications in land plants .
| Segment | Sequence |
|---|---|
| 1–50 | MRFPQPHRNGGETQQHFHSTISLQKLKRFNSLILVFRFSAFCFSLASAVF |
| 51–100 | LTNSRGSDSFHWYNFDAFRYVFAANAIVAVYSLFEMTAAVWEISRNATLFPEVCQVWFDFGH |
| 101–150 | DQVFAYLLLSANSTGSEMARTMKDACTDNKPFCVQSDIAIALGFVGFLFLGVSSLFSGFRVVCFIIN |
| 151–186 | GSRFYV (terminus) |
CASPL proteins, including POPTRDRAFT_820327, are hypothesized to form membrane domains analogous to CASPs, which create diffusion barriers in plant endodermal cells . These domains restrict lateral movement of membrane proteins (e.g., NOD26-LIKE INTRINSIC PROTEIN5;1) and lipid probes, enabling polarized localization .
CASPs recruit peroxidases to mediate lignin deposition at Casparian strips, a critical step in root selectivity . While direct evidence for POPTRDRAFT_820327 is limited, its structural homology suggests potential roles in similar processes, particularly in P. trichocarpa root development.
CASPLs are conserved across land plants and green algae, with homologs in the MARVEL family outside plants . This conservation highlights their ancient evolutionary origin and functional importance in membrane organization .
The protein is used in:
Membrane Scaffold Potential: CASPLs, when ectopically expressed, integrate into CASP membrane domains, suggesting shared structural roles .
MARVEL Domain Homology: Conserved residues in transmembrane regions imply a role in membrane stabilization .
Endodermis-Specific Functions: In rice and Arabidopsis, CASP-like genes (e.g., OsCASP_like11/19, AtCASP_like1/31) are implicated in Casparian strip formation and ion transport .
KEGG: pop:POPTR_0008s05360g
POPTRDRAFT_820327 is a CASP-like protein from Populus trichocarpa (Western balsam poplar), also known as Populus balsamifera subsp. trichocarpa. The protein has a UniProt accession number of B9HMF8 and is characterized as a full-length protein consisting of 186 amino acids . The recommended name in scientific literature is "CASP-like protein POPTRDRAFT_820327" with POPTRDRAFT_820327 being the designated ORF name for the gene that encodes this protein .
When referencing this protein in scientific literature, researchers should use the full nomenclature "CASP-like protein POPTRDRAFT_820327" on first mention, along with the organism name "Populus trichocarpa" and UniProt accession number (B9HMF8) . For subsequent mentions, "POPTRDRAFT_820327" is sufficient. Avoid creating nonstandard abbreviations. When describing recombinant versions, specify the expression system (e.g., "Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_820327 expressed in E. coli") and tag information if applicable .
POPTRDRAFT_820327 has been successfully expressed in both prokaryotic (E. coli) and eukaryotic (yeast) expression systems . The E. coli-expressed version is documented to include a His-tag, while the tag type for the yeast-expressed version is determined during the manufacturing process . Both systems appear to produce functional protein, though there may be differences in post-translational modifications between the two expression hosts. The choice between expression systems should be guided by the specific experimental requirements, with yeast potentially offering more plant-like post-translational modifications .
Based on the available commercial preparations, purification of POPTRDRAFT_820327 typically involves affinity chromatography utilizing the attached His-tag or other fusion tags . Researchers should implement a purification strategy that includes: (1) initial capture using affinity chromatography; (2) intermediate purification via ion exchange chromatography; and (3) polishing steps through size exclusion chromatography to achieve high purity. The commercial preparations report a purity level of >85% as determined by SDS-PAGE analysis . For laboratory-scale purification, consider including protease inhibitors during lysis to prevent degradation, and optimize buffer conditions to maintain protein stability throughout the purification process.
The optimal storage conditions for POPTRDRAFT_820327 are at -20°C or -80°C, with the latter providing better long-term stability . The shelf life depends on formulation: liquid preparations typically remain stable for approximately 6 months, while lyophilized formulations maintain stability for up to 12 months . For working stocks, aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they significantly compromise protein integrity . The protein's stability is enhanced by the addition of glycerol (recommended at 5-50% final concentration) when stored in liquid form .
To reconstitute lyophilized POPTRDRAFT_820327, first briefly centrifuge the vial to bring contents to the bottom . Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . For long-term storage, add glycerol to a final concentration of 5-50% (with 50% being commonly used as a default) . After reconstitution, divide the solution into small working aliquots to minimize freeze-thaw cycles. Document reconstitution date, concentration, and buffer composition on each aliquot. For critical experiments, verify protein activity after reconstitution to ensure functionality has been preserved.
Given the limited published information on POPTRDRAFT_820327's specific function, researchers should employ multiple complementary approaches:
Comparative genomic analysis: Align the sequence with characterized CASP-family proteins across species to identify conserved functional domains and predict potential roles .
Subcellular localization studies: Express fluorescently-tagged POPTRDRAFT_820327 in plant cells to determine its localization pattern, which can provide insights into potential functions (e.g., cell membrane, endoplasmic reticulum, Golgi).
Interaction studies: Perform yeast two-hybrid assays, co-immunoprecipitation, or pull-down assays to identify protein interaction partners, as these interactions may illuminate functional pathways .
Loss-of-function and gain-of-function studies: Generate knockout or overexpression lines in model plant systems to observe resulting phenotypes.
Gene expression analysis: Examine expression patterns under different environmental conditions, developmental stages, and in response to stressors.
These approaches should be conducted in parallel to build a comprehensive understanding of POPTRDRAFT_820327's biological role in Populus trichocarpa.
To elucidate the biological pathways involving POPTRDRAFT_820327:
Pathway reconstruction: Begin with bioinformatic prediction of pathways based on sequence homology with known CASP-family proteins, which are typically involved in cell wall formation and casparian strip development in plants .
Transcriptomics approach: Perform RNA-Seq analysis comparing wild-type plants with those showing altered POPTRDRAFT_820327 expression to identify co-regulated genes.
Metabolomics studies: Analyze metabolite profiles in plants with modified POPTRDRAFT_820327 expression to identify affected metabolic pathways.
Proteomics analysis: Implement quantitative proteomics to identify proteins whose abundance changes in response to POPTRDRAFT_820327 manipulation.
Functional complementation: Test whether POPTRDRAFT_820327 can functionally complement known CASP mutants in model plants like Arabidopsis to confirm hypothesized pathway involvement.
Document all experimental conditions meticulously, as slight variations may significantly impact pathway analysis results.
For comprehensive structural characterization of POPTRDRAFT_820327, consider the following methodological approaches:
Secondary structure prediction: Utilize computational tools to predict alpha-helices, beta-sheets, and transmembrane domains based on the amino acid sequence.
X-ray crystallography: Optimize crystallization conditions using purified protein to determine high-resolution three-dimensional structure. Initial screening should include varying protein concentrations (5-15 mg/mL), pH ranges (5.0-8.5), and different precipitants.
Nuclear Magnetic Resonance (NMR) spectroscopy: For structural analysis in solution, especially useful for examining dynamic regions and protein-protein interactions.
Circular Dichroism (CD) spectroscopy: To analyze secondary structure content and thermal stability under different buffer conditions.
Cryo-electron microscopy: Particularly valuable if POPTRDRAFT_820327 forms larger complexes or if crystallization proves challenging.
Limited proteolysis: To identify stable domains and flexible regions within the protein structure.
Combining these methods will provide a more complete structural understanding than any single approach alone.
Based on sequence analysis of the 186 amino acid POPTRDRAFT_820327 protein, several structural features can be predicted:
Transmembrane domains: The sequence contains hydrophobic regions consistent with transmembrane segments (residues approximately 19-39 and 120-140), suggesting a membrane-associated function .
Signal peptide: The N-terminal region (approximately residues 1-18) displays characteristics of a signal peptide, indicating the protein likely enters the secretory pathway .
Conserved motifs: The sequence contains regions consistent with the CASP (Casparian strip membrane domain protein) family, including the typical four transmembrane domain architecture .
Post-translational modification sites: Potential glycosylation and phosphorylation sites can be predicted using computational tools, though experimental verification is necessary.
Potential disulfide bonds: The presence of cysteine residues suggests possible disulfide bond formation that may stabilize the tertiary structure.
These predicted features align with the protein's classification as a CASP-like protein, which typically functions in the formation of diffusion barriers in plant cell walls.
To investigate POPTRDRAFT_820327 protein-protein interactions:
Yeast two-hybrid (Y2H): Clone the POPTRDRAFT_820327 coding sequence into both bait and prey vectors to identify potential interacting partners from a Populus trichocarpa cDNA library. Use both full-length protein and domain-specific constructs to pinpoint interaction regions .
Pull-down assays: Express His-tagged POPTRDRAFT_820327 and use Ni-NTA resin to capture the protein along with its binding partners from plant cell lysates. Identify interacting proteins via mass spectrometry .
Bimolecular Fluorescence Complementation (BiFC): Fuse POPTRDRAFT_820327 and candidate interaction partners to complementary fragments of fluorescent proteins to visualize interactions in living plant cells.
Co-immunoprecipitation (Co-IP): Use antibodies specific to POPTRDRAFT_820327 or its epitope tag to precipitate protein complexes from plant extracts, followed by western blot or mass spectrometry analysis of co-precipitated proteins .
Surface Plasmon Resonance (SPR) or Isothermal Titration Calorimetry (ITC): For quantitative analysis of binding affinities between purified POPTRDRAFT_820327 and candidate interacting proteins.
Document interaction strength, specificity, and the cellular context in which these interactions occur.
To comprehensively analyze POPTRDRAFT_820327 expression patterns:
Quantitative RT-PCR: Design gene-specific primers spanning exon-exon junctions to quantify POPTRDRAFT_820327 transcript levels across different tissues, developmental stages, and environmental conditions.
RNA in situ hybridization: Develop specific RNA probes to visualize spatial expression patterns within tissue sections, particularly useful for examining expression in specific cell types within complex tissues.
Promoter-reporter fusion constructs: Clone the POPTRDRAFT_820327 promoter region (approximately 2kb upstream of the transcription start site) and fuse it to reporter genes such as GUS or GFP to track expression patterns in transgenic Populus lines.
Immunohistochemistry: Generate specific antibodies against POPTRDRAFT_820327 or use epitope-tagged versions to detect protein localization in tissue sections.
Single-cell RNA-Seq: For high-resolution analysis of expression patterns at the cellular level, particularly valuable for identifying cell type-specific expression.
Implement appropriate normalization methods and include sufficient biological replicates (minimum n=3) to account for natural variation in expression levels.
A standardized protocol for reconstitution and dilution of POPTRDRAFT_820327 includes:
Preparation:
Centrifuge the vial briefly before opening to collect all material at the bottom
Allow lyophilized protein to reach room temperature before opening
Reconstitution:
Stabilization:
Aliquoting:
Storage:
This protocol maximizes protein stability and experimental reproducibility when working with POPTRDRAFT_820327.
To comprehensively evaluate POPTRDRAFT_820327 purity and integrity:
SDS-PAGE analysis:
Western blotting:
Use antibodies against the protein itself or its affinity tag (e.g., His-tag)
Assess both for the presence of the full-length protein and any degradation products
Mass spectrometry:
MALDI-TOF or ESI-MS to confirm molecular weight
Peptide mass fingerprinting to verify sequence identity
Look for post-translational modifications that may affect functionality
Size exclusion chromatography:
Analyze oligomeric state and detect potential aggregation
Use in combination with multi-angle light scattering (SEC-MALS) for precise molecular weight determination
Dynamic light scattering (DLS):
Assess sample homogeneity and identify potential aggregation
Monitor protein stability over time and under different buffer conditions
These methods should be used in combination to ensure comprehensive quality assessment before proceeding with functional experiments.
When encountering poor expression or low solubility of POPTRDRAFT_820327:
Optimization of expression conditions:
Solubility enhancement strategies:
Test different fusion tags (MBP, GST, SUMO) which may enhance solubility compared to His-tag alone
Optimize lysis buffer composition by testing different detergents (DDM, CHAPS, Triton X-100) for this membrane-associated protein
Include stabilizing agents such as glycerol (5-10%) or low concentrations of reducing agents
Refolding from inclusion bodies:
If the protein predominantly forms inclusion bodies, develop a refolding protocol
Solubilize inclusion bodies using 8M urea or 6M guanidine hydrochloride
Perform gradual dialysis to remove denaturant while adding stabilizing agents
Co-expression with chaperones:
Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) to aid proper folding
For eukaryotic expression systems, consider co-expression with plant-specific chaperones
Alternative expression systems:
If E. coli and yeast systems yield poor results, consider plant-based expression systems which may provide the appropriate cellular environment for proper folding
Document all optimization attempts systematically to identify conditions that maximize protein yield and solubility.
Common experimental pitfalls when studying POPTRDRAFT_820327 and their solutions include:
Protein degradation issues:
Functionality assessment challenges:
Pitfall: Lack of established functional assays for CASP-like proteins
Solution: Develop multiple indirect assays based on predicted functions, including membrane integration assays, interaction studies with known cell wall components, and complementation of known CASP mutants
Non-specific interactions:
Pitfall: False positive results in interaction studies
Solution: Include appropriate negative controls, validate interactions using multiple methodologies, and perform competition assays with unlabeled protein
Expression system artifacts:
Buffer compatibility issues:
Pitfall: Protein precipitation or inactivation in experimental buffers
Solution: Test protein stability in each experimental buffer before proceeding with functional assays; consider using native-like membrane environments for functional studies of this putative membrane protein
Improper controls:
Pitfall: Inadequate control samples leading to misinterpretation
Solution: Include both positive controls (known CASP family proteins) and negative controls (unrelated proteins of similar size/properties) in all experiments
Systematic documentation of experimental conditions and regular quality control assessments will help identify and address these pitfalls early in the research process.
To effectively compare POPTRDRAFT_820327 with other CASP-like proteins:
Sequence alignment methodology:
Perform multiple sequence alignments using MUSCLE or CLUSTAL algorithms
Include well-characterized CASP proteins from model plants (Arabidopsis thaliana) and other woody species
Focus analysis on conserved domains and motifs characteristic of CASP family proteins
Generate phylogenetic trees using maximum likelihood or Bayesian methods to place POPTRDRAFT_820327 in evolutionary context
Structural comparison approaches:
Use homology modeling based on available CASP protein structures
Compare predicted transmembrane topologies and domain organizations
Identify conserved residues that may be critical for function based on structural alignment
Expression pattern comparison:
Compare tissue-specific and condition-responsive expression patterns between POPTRDRAFT_820327 and other CASP family members
Look for co-expression patterns that may indicate functional relationships
Functional complementation experiments:
Test whether POPTRDRAFT_820327 can functionally replace other CASP proteins in heterologous systems
Document the degree of functional conservation or specialization within the family
This systematic comparative approach will help position POPTRDRAFT_820327 within the broader context of CASP protein biology and evolution.
When analyzing experimental data for POPTRDRAFT_820327:
Expression data analysis:
Use ANOVA with post-hoc tests (Tukey's HSD, Bonferroni) for comparing expression levels across multiple conditions
Apply FDR correction for multiple testing when analyzing transcriptomic datasets
Implement principal component analysis (PCA) to identify patterns in multivariate expression data
Protein-protein interaction analysis:
Calculate binding affinities (Kd values) from SPR or ITC data using appropriate binding models
Perform statistical comparison of interaction strengths using t-tests or non-parametric alternatives
For large-scale interaction studies, implement appropriate network analysis methods with significance testing
Structural data analysis:
For CD spectroscopy data, use statistical deconvolution algorithms to estimate secondary structure content
Implement bootstrap methods to assess the reliability of structural predictions
For crystallography data, evaluate model quality using R-factors and geometric validation statistics
Functional assay analysis:
Use dose-response curves and EC50/IC50 calculations where appropriate
Implement linear or non-linear regression models for analyzing kinetic data
For phenotypic studies, use appropriate categorical statistical methods and survival analysis where applicable
Sample size and power considerations:
Conduct a priori power analysis to determine adequate sample sizes
Report effect sizes along with p-values
Consider using Bayesian statistical approaches for small sample sizes
Document all statistical methods, software packages, and parameters used to ensure reproducibility of analyses.