Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_822486 (POPTRDRAFT_822486)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Nomenclature and Classification

  • Full Name: CASP-like protein POPTRDRAFT_822486

  • Gene Name: POPTRDRAFT_822486

  • Family: CASP/CASPL (Casparian strip membrane domain proteins)

  • Function: Predicted involvement in plasma membrane domain organization and cell wall modification, based on homology to CASP proteins .

Expression System

  • Host: Escherichia coli .

  • Tag: His-tag (N-terminal) for affinity purification .

Stability and Handling

  • Thermal Stability: Stable at -20°C/-80°C; working aliquots at 4°C for ≤1 week .

  • Solubility: Reconstituted in deionized water (0.1–1.0 mg/mL) with optional glycerol (5–50%) .

Functional Homology

  • Role: Likely mediates membrane domain formation and lignin deposition, similar to CASP1-5 in root endodermis .

  • Interaction Partners: Predicted to interact with peroxidases for cell wall modification, though direct evidence for POPTRDRAFT_822486 is lacking .

Research Findings and Applications

Functional Insights

  • Membrane Scaffold Formation: CASP/CASPL proteins create diffusion barriers in plant membranes, restricting lateral movement of lipids and proteins .

  • Cell Wall Modification: CASPs recruit peroxidases to polymerize lignin into Casparian strips, critical for root radial transport .

Emerging Roles

  • Developmental Regulation: In Arabidopsis, CASPL4C1 deletion enhances growth and biomass, suggesting roles in developmental timing .

  • Stress Response: A cold-induced CASPL homolog in watermelon (ClCASPL) may regulate stress adaptation .

Knowledge Gaps

  • Direct Functional Studies: Limited experimental data on POPTRDRAFT_822486; inferences rely on CASP/CASPL family studies .

  • Interactome: No confirmed interactors reported for this protein in Populus .

Amino Acid Sequence Analysis

Key Features:

  • Conserved Motifs: MARVEL-like domains in transmembrane regions (TM1/TM3) .

  • Functional Sites: Extracellular loops (EL1/EL2) may interact with secreted enzymes for lignin deposition .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific requests. Please indicate your preferred format in the order notes, and we will strive to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: Our standard shipping includes blue ice packs. If dry ice shipment is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing should be avoided. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please communicate it to us. We will prioritize developing the specified tag.
Synonyms
POPTRDRAFT_822486; CASP-like protein 4C2; PtCASPL4C2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Target Names
POPTRDRAFT_822486
Target Protein Sequence
MRSPQPHRSGGDTQQHFQSTVSVQKLKRFNSLILVFRFAAFCFSLASAVFMLTNSRGSDS LHWYNFDAFRYVFAANAIVAIYSLFEMAASVWEISRNATLFPEICQVWFDFGHDQVFAYL LLSANTAGTELARTLKDTCTDNKAFCVQSDIAIVLGFAGFLFLGISSLFSGFRVVCFIIN GSRFYV
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How do storage conditions affect the stability of recombinant POPTRDRAFT_822486?

Optimal storage conditions for recombinant POPTRDRAFT_822486 are critical for maintaining its biological activity. The protein is typically stored in a Tris-based buffer with 50% glycerol at -20°C, and for extended stability, conservation at -80°C is recommended . Repeated freeze-thaw cycles significantly reduce protein stability and should be avoided. Working aliquots can be maintained at 4°C for up to one week without significant degradation .

For experimental protocols requiring prolonged use, it is advisable to prepare small working aliquots from the stock solution to minimize repeated freezing and thawing. Stability assessments using SDS-PAGE before experimental use are recommended to ensure protein integrity, particularly when working with older stocks.

What are the optimal expression systems for producing recombinant POPTRDRAFT_822486?

Recombinant POPTRDRAFT_822486 can be successfully expressed in several host systems, with E. coli being the most commonly utilized for basic research applications . The choice of expression system depends on experimental requirements:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliRapid growth, simple cultivation, cost-effective, high yieldLimited post-translational modifications, possible inclusion body formation1-10 mg/L culture
Yeast (S. cerevisiae, P. pastoris)Post-translational modifications, secretion capabilityLonger expression time, complex media requirements0.5-5 mg/L culture
Insect cellsMore complex eukaryotic modificationsHigher cost, technical expertise required0.5-2 mg/L culture
Mammalian cellsFull post-translational modificationsHighest cost, lowest yield, complex maintenance0.1-1 mg/L culture

What purification strategies yield the highest purity for recombinant POPTRDRAFT_822486?

Purification of recombinant POPTRDRAFT_822486 typically employs affinity chromatography as the primary purification step, with histidine-tagged variants being most common . A comprehensive purification workflow includes:

  • Initial capture by affinity chromatography: For His-tagged POPTRDRAFT_822486, Ni²⁺-charged affinity media is used with binding buffers containing 20-40 mM imidazole to reduce non-specific binding .

  • Intermediate purification: Size exclusion chromatography separates the target protein from aggregates and smaller contaminants.

  • Polishing step: Ion exchange chromatography can further enhance purity based on the protein's charge properties.

For optimal results, sample preparation should include:

  • Cell lysis under conditions that maintain protein solubility

  • Clarification by centrifugation at 10,000-15,000g for 30 minutes

  • Filtration through a 0.45 μm membrane before loading onto columns

  • Buffer optimization to maintain protein stability throughout the process

This multi-step approach typically yields >95% pure protein suitable for structural and functional studies .

What biophysical techniques are most effective for characterizing the structural properties of POPTRDRAFT_822486?

Multiple complementary biophysical techniques provide comprehensive structural characterization of POPTRDRAFT_822486:

  • Circular Dichroism (CD) Spectroscopy: Provides information about secondary structure composition (α-helices, β-sheets, random coils) and can monitor thermal stability and folding/unfolding transitions.

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): Determines the absolute molecular weight and oligomeric state under native conditions.

  • Differential Scanning Calorimetry (DSC): Measures the thermal stability and domain organization by monitoring heat capacity changes during temperature-induced unfolding.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: For detailed atomic-level structural information, particularly useful for analyzing membrane-associated domains typical of CASP-like proteins.

  • X-ray Crystallography: Provides high-resolution three-dimensional structure if crystals can be obtained, though membrane-associated proteins like POPTRDRAFT_822486 can be challenging to crystallize.

For membrane interaction studies, which are particularly relevant given the protein's likely role in membrane barriers, additional techniques like lipid monolayer surface pressure measurements and liposome binding assays provide valuable functional insights.

How can researchers assess the functional activity of recombinant POPTRDRAFT_822486 in vitro?

Assessing the functional activity of POPTRDRAFT_822486 requires approaches that examine its membrane interactions and potential role in forming barriers:

  • Membrane Binding Assays: Using liposomes of varying compositions to determine lipid binding preferences and strength.

  • Protein-Protein Interaction Studies: Pull-down assays or surface plasmon resonance to identify binding partners within the Casparian strip formation machinery.

  • Reconstitution Experiments: Formation of artificial membranes with POPTRDRAFT_822486 to observe barrier properties.

  • Fluorescence Recovery After Photobleaching (FRAP): When using fluorescently labeled protein, FRAP can assess mobility and interactions within membranes.

  • Electrophysiological Measurements: Using artificial membranes to determine if POPTRDRAFT_822486 affects membrane permeability.

Activity assays should include appropriate controls, including heat-denatured protein and related proteins with known functions for comparison. Quantitative measurements of binding affinities and kinetic parameters provide robust data for comparative analyses across experimental conditions.

What are the most effective antibody-based detection methods for POPTRDRAFT_822486 in experimental systems?

Detection of POPTRDRAFT_822486 can be accomplished through several antibody-based approaches:

  • Western Blotting: Particularly effective when using tag-specific antibodies (anti-His) for recombinant protein detection. For the native protein, custom antibodies against unique epitopes provide specificity.

  • Immunohistochemistry/Immunofluorescence: Useful for localizing the protein in plant tissues, particularly in root endodermis where Casparian strips form.

  • ELISA: Quantitative detection in complex samples, with recombinant POPTRDRAFT_822486 serving as a standard for calibration curves .

  • Immunoprecipitation: For isolating protein complexes containing POPTRDRAFT_822486 from plant extracts.

When developing detection protocols, consider:

  • Optimal antibody dilutions (typically starting at 1:1000 for Western blots)

  • Blocking conditions (5% non-fat milk or BSA)

  • Incubation times and temperatures (overnight at 4°C often provides best sensitivity)

  • Secondary antibody selection based on detection system

For experiments requiring higher sensitivity, enhanced chemiluminescence detection systems are recommended for Western blots, while tyramide signal amplification can enhance immunohistochemistry signals in plant tissue sections.

How can POPTRDRAFT_822486 be effectively used in studying plant cell wall development?

POPTRDRAFT_822486, as a CASP-like protein, likely plays a role in forming apoplastic barriers in Populus trichocarpa. Research applications include:

  • Transgenic Studies: Overexpression or knockdown/knockout approaches in model plants to observe effects on barrier formation and function.

  • Localization Studies: Using fluorescently tagged versions to track localization during development and in response to environmental stresses.

  • Interaction Mapping: Identifying protein interaction networks involved in Casparian strip formation using the recombinant protein as bait.

  • Comparative Studies: Analyzing functional differences between POPTRDRAFT_822486 and related proteins from other species to understand evolutionary adaptations.

  • Environmental Response Analysis: Examining expression and localization changes under various stress conditions (drought, salinity, heavy metals).

Experimental designs should include appropriate controls, time-course analyses to capture developmental changes, and multiple complementary approaches to validate findings. Physiological measurements of barrier function (e.g., apoplastic tracer penetration) provide functional context to molecular observations.

What are the challenges in studying post-translational modifications of POPTRDRAFT_822486?

Investigating post-translational modifications (PTMs) of POPTRDRAFT_822486 presents several methodological challenges:

  • Expression System Selection: E. coli expression systems, while convenient, lack the machinery for many eukaryotic PTMs. For comprehensive PTM studies, expression in yeast, insect, or plant cell systems is preferable .

  • Modification Detection: Mass spectrometry-based approaches are essential for comprehensive PTM mapping:

    • Phosphorylation sites: Enrichment with TiO₂ or IMAC prior to MS analysis

    • Glycosylation: Specialized workflows using lectin affinity and specific enzymatic treatments

    • Lipid modifications: Requiring special extraction and ionization techniques

  • Functional Relevance: Site-directed mutagenesis of potential modification sites (changing Ser/Thr to Ala for phosphorylation sites) can help determine the functional significance of specific PTMs.

  • Endogenous vs. Recombinant Comparison: Extraction and analysis of the native protein from plant tissues is necessary to validate PTMs found in recombinant systems.

The technical complexity increases when studying membrane-associated proteins like POPTRDRAFT_822486, requiring specialized solubilization protocols that preserve modifications while efficiently extracting the protein.

How can researchers troubleshoot protein aggregation issues when working with recombinant POPTRDRAFT_822486?

Aggregation is a common challenge when working with membrane-associated proteins like POPTRDRAFT_822486. Systematic troubleshooting approaches include:

  • Buffer Optimization:

    • Screen various pH conditions (typically pH 6.0-8.0)

    • Test different ionic strengths (50-500 mM NaCl)

    • Evaluate stabilizing additives (5-10% glycerol, 1-5 mM DTT, 0.5-1 M arginine)

  • Solubilization Strategies:

    • Mild detergents (0.03-0.1% DDM, 0.5-1% CHAPS)

    • Amphipols or nanodiscs for membrane protein stabilization

    • Co-expression with chaperones to improve folding

  • Expression Conditions:

    • Lower induction temperatures (16-20°C)

    • Reduced inducer concentrations

    • Extended expression times with slower growth

  • Purification Modifications:

    • Include detergents in all purification buffers

    • Consider on-column refolding protocols

    • Immediate size exclusion chromatography after affinity purification

  • Analytical Assessment:

    • Dynamic light scattering to monitor aggregation state

    • Thermal shift assays to identify stabilizing conditions

    • Size exclusion chromatography with multi-angle light scattering for accurate molecular weight determination

A systematic approach testing multiple conditions in parallel, with quantitative assessment of protein quality at each step, is most effective for resolving aggregation issues.

How does POPTRDRAFT_822486 compare structurally and functionally to CASP proteins in other plant species?

POPTRDRAFT_822486 belongs to the CASP protein family, which plays crucial roles in forming Casparian strips in plant roots. Comparative analysis reveals:

  • Sequence Conservation: CASP-like proteins show moderate sequence conservation across plant species, with highest similarity in transmembrane domains and specific motifs involved in protein-protein interactions.

  • Functional Domains: Key structural elements include:

    • N-terminal signal sequence

    • Four predicted transmembrane domains

    • Conserved aromatic residues that likely facilitate membrane localization and protein interactions

  • Evolutionary Adaptations: Populus species have evolved distinct features in their CASP proteins that may reflect adaptation to specific environmental conditions:

    • Altered hydrophobicity profiles in certain transmembrane regions

    • Species-specific insertions/deletions in loop regions

    • Differences in potential phosphorylation sites

  • Expression Patterns: Unlike Arabidopsis CASPs that are primarily expressed in root endodermis, POPTRDRAFT_822486 may have broader expression patterns across different tissues, suggesting expanded functional roles in woody plants.

Phylogenetic analysis places POPTRDRAFT_822486 in a clade with other CASP-like proteins from woody perennials, distinct from herbaceous model plants, potentially reflecting specialization for long-lived woody plant physiology.

What are the methodological considerations for studying POPTRDRAFT_822486 interactions with other components of the Casparian strip formation machinery?

Investigating protein interaction networks involving POPTRDRAFT_822486 requires specialized approaches for membrane-associated protein complexes:

  • Membrane Yeast Two-Hybrid Systems: Modified Y2H systems designed specifically for membrane proteins can identify direct interaction partners.

  • Co-Immunoprecipitation Strategies:

    • Crosslinking prior to extraction (using DSP or formaldehyde)

    • Digitonin or mild detergent solubilization

    • Native elution conditions to preserve complexes

  • Proximity Labeling Approaches:

    • BioID or TurboID fusions expressed in planta

    • APEX2-based labeling in reconstituted systems

    • Quantitative proteomics to identify neighboring proteins

  • Fluorescence-Based Interaction Studies:

    • Förster Resonance Energy Transfer (FRET)

    • Bimolecular Fluorescence Complementation (BiFC)

    • Fluorescence Correlation Spectroscopy (FCS)

  • Reconstitution Experiments:

    • Liposome-based reconstitution with purified components

    • Assessment of complex formation using analytical ultracentrifugation

    • Electron microscopy of reconstituted complexes

These methodologies should be employed in complementary combinations, as each has specific strengths and limitations. Control experiments using mutated versions of POPTRDRAFT_822486 with disrupted interaction interfaces can validate the specificity of observed interactions.

What are the emerging technologies that could enhance POPTRDRAFT_822486 research?

Several cutting-edge technologies are poised to revolutionize research on POPTRDRAFT_822486 and related proteins:

  • Cryo-Electron Microscopy: Advances in sample preparation and image processing now enable structural determination of membrane protein complexes without crystallization, potentially revealing POPTRDRAFT_822486 in its native membrane environment.

  • AlphaFold and Other AI Structure Prediction Tools: These can provide structural models even in the absence of experimental structures, facilitating hypothesis generation about functional domains and interaction interfaces.

  • CRISPR-Based Genome Editing in Populus: Improved transformation protocols and editing efficiency in tree species now enable precise genetic manipulation to study POPTRDRAFT_822486 function in its native context.

  • Single-Cell Transcriptomics and Proteomics: These approaches can reveal cell-specific expression patterns and protein abundance across different tissues and developmental stages.

  • Advanced Imaging Techniques:

    • Super-resolution microscopy for detailed localization studies

    • Light sheet microscopy for dynamic 3D imaging in plant tissues

    • Correlative light and electron microscopy for contextualizing molecular observations

Implementing these emerging technologies in POPTRDRAFT_822486 research will require interdisciplinary collaboration but offers unprecedented opportunities to understand this protein's role in Populus biology.

How can systems biology approaches enhance our understanding of POPTRDRAFT_822486 function in plant development?

Systems biology frameworks provide powerful approaches to contextualize POPTRDRAFT_822486 function within broader biological networks:

  • Multi-Omics Integration:

    • Combining transcriptomics, proteomics, and metabolomics data

    • Correlation of POPTRDRAFT_822486 expression with physiological parameters

    • Network analysis to identify co-regulated genes and proteins

  • Mathematical Modeling:

    • Kinetic models of Casparian strip formation

    • Spatial modeling of barrier development

    • Predictive models of how perturbations affect barrier function

  • Environmental Response Mapping:

    • Systematic analysis of expression and localization under diverse stresses

    • Correlation with physiological measurements of barrier integrity

    • Comparative analysis across different Populus genotypes/species

  • Developmental Trajectory Analysis:

    • Time-course studies throughout root development

    • Single-cell resolution of expression patterns

    • Spatiotemporal modeling of protein localization and barrier formation

These integrative approaches can reveal emergent properties not evident from reductionist studies, placing POPTRDRAFT_822486 function in the broader context of plant development and environmental adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.