Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_834139 (POPTRDRAFT_834139)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, should you have any specific format requirements, kindly indicate them in your order remarks. We will then prepare the product according to your request.
Lead Time
The delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
POPTRDRAFT_834139; CASP-like protein 2A1; PtCASPL2A1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Target Names
POPTRDRAFT_834139
Target Protein Sequence
MEKRDKGSSPMATMMGSRDENEDVENTTRTAETMLRLVPMALCVSALVVMLKNTQTNDYG SLSYSDLGAFRYLVHVNGICAGYSLLSAVIVAMPRASTMPRAWAFFLLDQVLTYVILAAG TVSTEVLYLASKGDTTITWSEACVSFGGFCHKALISIVITFVVVICYAALSLLSSYKLFS KYDSPVLTYPGKGIEIATFHG
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How are recombinant POPTRDRAFT_834139 proteins typically produced for research purposes?

Recombinant POPTRDRAFT_834139 protein is typically produced in E. coli expression systems with an N-terminal His tag to facilitate purification. The expression construct contains the full-length protein (amino acids 1-201). After expression, the protein is purified and supplied as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .

For reconstitution, researchers should:

  • Centrifuge the vial briefly before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimal: 50%) for long-term storage

  • Aliquot and store at -20°C/-80°C to avoid repeated freeze-thaw cycles

What is the evolutionary relationship between POPTRDRAFT_834139 and other CASP-like proteins?

POPTRDRAFT_834139 belongs to the CASP-like (CASPL) protein family, which is found across all major divisions of land plants as well as in green algae. Phylogenetic analysis indicates that CASPLs are evolutionarily related to the MARVEL protein family found outside the plant kingdom .

The CASPL family likely evolved from ancestral four-transmembrane proteins, with specialization occurring for different functions in plants. The emergence of the Casparian strip in plants correlates with the appearance of CASP-specific signatures in genomes. Plants lacking Casparian strips typically do not contain proteins with these CASP-specific signatures, supporting the evolutionary specialization of these proteins for specific cellular barrier functions .

What is the proposed cellular localization and function of POPTRDRAFT_834139?

Based on studies of other CASP-like proteins, POPTRDRAFT_834139 is likely localized to the plasma membrane where it may contribute to the formation of specialized membrane domains. CASPs and CASPLs generally show the propensity to form transmembrane scaffolds that can direct cell wall modifications at specific locations .

While the exact function of POPTRDRAFT_834139 has not been fully characterized, its classification as a CASP-like protein suggests potential involvement in:

  • Formation of membrane domain scaffolds

  • Direction of localized cell wall modifications

  • Potential recruitment of cell wall biosynthesis or modification enzymes

  • Establishment of plasma membrane diffusion barriers

What experimental approaches are recommended for investigating POPTRDRAFT_834139 interactions with cell wall biosynthesis machinery?

To investigate POPTRDRAFT_834139 interactions with cell wall biosynthesis machinery, researchers should consider a multi-layered approach:

  • Protein-Protein Interaction Studies:

    • Yeast two-hybrid screening to identify potential interacting partners

    • Co-immunoprecipitation followed by mass spectrometry to validate interactions in planta

    • Bimolecular Fluorescence Complementation (BiFC) to visualize interactions in vivo

  • Co-expression Network Analysis:

    • Utilize RNA-seq data such as the P. trichocarpa DOE Joint Genome Institute Plant Gene Atlas to identify genes co-expressed with POPTRDRAFT_834139

    • Apply a threshold of Spearman correlation coefficient ≥0.85 to identify strongly co-expressed genes

    • Map POPTRDRAFT_834139 within lignin and cell wall regulatory networks

  • Genome-Wide Association Studies:

    • Correlate SNP variations in POPTRDRAFT_834139 with cell wall phenotypes

    • Examine rare variant associations using approaches similar to the Sequence Kernel Association Test (SKAT)

  • In vitro Reconstitution:

    • Express and purify POPTRDRAFT_834139 along with candidate interacting proteins

    • Test direct binding and functional effects on enzyme activities related to cell wall formation

When interpreting results, consider that CASPs can perform two uncoupled activities: forming membrane scaffolds and directing cell wall modifications .

How can researchers differentiate between the membrane scaffold and cell wall modification functions of POPTRDRAFT_834139?

Differentiating between these two functions requires specific experimental designs:

  • Membrane Scaffold Function Assessment:

    • Fluorescent protein tagging (e.g., GFP fusion) to visualize domain formation in living cells

    • Fluorescence Recovery After Photobleaching (FRAP) to measure protein mobility and stability

    • Lateral diffusion analysis using lipophilic fluorescent markers to test barrier function

    • Deletion constructs of extracellular loops to test their dispensability for scaffold formation

  • Cell Wall Modification Function Assessment:

    • Lignin-specific staining (e.g., using Basic Fuchsin) to visualize cell wall modifications

    • Co-localization studies with peroxidases that mediate lignin deposition

    • Yeast two-hybrid or pull-down assays to identify interactions with cell wall modification enzymes

    • Genetic complementation experiments in casp mutants to assess functional recovery

Function ComparisonMembrane ScaffoldCell Wall Modification
Key AssaysFRAP, lateral diffusionLignin staining, enzyme interactions
Temporal SequencePrecedes wall modificationFollows scaffold formation
Genetic RequirementsIndependent of lignin depositionRequires scaffold formation
Protein DomainsTransmembrane regions criticalMay involve extracellular regions

Research has demonstrated that these functions can be uncoupled, as (1) formation of the CASP domain occurs independently from lignin deposition, and (2) interactions between CASPs and peroxidases can occur outside the Casparian Strip Domain when CASPs are ectopically expressed .

What considerations are important when designing gene expression studies for POPTRDRAFT_834139 and related CASP-like genes?

When designing gene expression studies:

  • Tissue Specificity:

    • Include multiple tissues, as CASP-like genes may have tissue-specific expression patterns

    • Pay particular attention to root tissues, especially the endodermis, where classical CASP functions have been characterized

    • Include vascular tissues where cell wall formation is highly active

  • Developmental Time Course:

    • Sample across developmental stages to capture temporal regulation

    • Focus on stages associated with active cell wall formation and maturation

  • Technical Considerations:

    • Use RNA extraction methods optimized for woody plant tissues

    • Include internal reference genes stable across tissues studied

    • Consider using RNA-seq for genome-wide expression patterns, allowing integration with:

      • Co-expression networks

      • Co-methylation data (using an absolute threshold of 0.95 for Spearman correlation)

      • Transcription factor binding site analysis

  • Data Integration:

    • Apply Lines of Evidence (LOE) approaches to combine expression data with:

      • Genome-wide association data

      • Methylation patterns

      • Protein-protein interaction networks

      • SNP correlation data

This integrated approach can help position POPTRDRAFT_834139 within the broader regulatory network controlling cell wall biosynthesis in Populus trichocarpa.

What methodologies are recommended for investigating the role of post-translational modifications in POPTRDRAFT_834139 function?

Post-translational modifications (PTMs) may significantly affect POPTRDRAFT_834139 function. To investigate PTMs:

  • Identification of PTMs:

    • Mass spectrometry-based proteomics on purified native protein

    • Phosphoproteomic analysis to identify phosphorylation sites

    • Glycoproteomic analysis for glycosylation patterns

    • Western blotting with modification-specific antibodies

  • Functional Analysis of PTMs:

    • Site-directed mutagenesis of putative modification sites

    • Expression of modified/unmodified protein variants

    • Comparison of localization, stability, and protein-protein interactions

  • PTM Dynamics:

    • Time-course experiments following cellular stimuli

    • Inhibitor studies targeting specific PTM-related enzymes

    • Co-expression analysis with genes encoding PTM-related enzymes

  • Simulation and Prediction:

    • Molecular dynamics simulations to predict structural changes

    • Computational prediction of PTM sites and their conservation

    • Structural modeling of how PTMs affect protein-protein interactions

When analyzing recombinant POPTRDRAFT_834139, researchers should be aware that E. coli-expressed proteins may lack eukaryotic PTMs present in the native Populus environment, potentially affecting function and interactions observed in vitro versus in planta.

What are the key considerations for designing experiments to study POPTRDRAFT_834139 localization in planta?

When designing experiments to study protein localization:

  • Expression System Selection:

    • Homologous expression in Populus system (ideal but technically challenging)

    • Heterologous expression in model plants (Arabidopsis as alternative)

    • Transient expression systems (tobacco leaves, protoplasts) for preliminary studies

  • Fusion Protein Design:

    • C-terminal vs. N-terminal fluorescent protein tags (consider both as position may affect localization)

    • Linker sequence optimization to minimize interference with protein function

    • Controls to verify fusion protein functionality

  • Microscopy Approaches:

    • Confocal microscopy for subcellular localization

    • Super-resolution microscopy for precise membrane domain analysis

    • Time-lapse imaging to capture dynamic localization patterns

    • FRAP to assess protein mobility within domains

  • Co-localization Studies:

    • With known membrane domain markers

    • With cell wall biosynthesis machinery

    • With other CASP family members

Based on findings with other CASP proteins, researchers should pay particular attention to potential transitions from initial broad plasma membrane localization to concentrated domains with high stability and low turnover .

How should researchers interpret potential discrepancies between in vitro and in vivo findings when studying POPTRDRAFT_834139?

When addressing discrepancies between in vitro and in vivo findings:

  • Protein Conformation Considerations:

    • Differences in protein folding between recombinant and native forms

    • Absence of post-translational modifications in E. coli-expressed proteins

    • Effects of His-tag or other fusion partners on protein structure/function

  • Cellular Context Factors:

    • Absence of native interaction partners in vitro

    • Different lipid environment affecting membrane protein behavior

    • Cell-type specific factors influencing protein function

  • Methodological Reconciliation:

    • Validate recombinant protein activity using functional assays

    • Perform complementation tests in mutant backgrounds

    • Use membrane mimetics for in vitro studies of membrane proteins

    • Consider native purification from plant material for critical experiments

  • Data Integration Approach:

    • Apply Lines of Evidence (LOE) methodology to evaluate consistency across multiple data types

    • Incorporate both in vitro biochemical data and in vivo functional data

    • Use network-based approaches to place contradictory findings in broader context

A systematic comparison table documenting differences between in vitro and in vivo findings can help identify patterns that explain discrepancies.

What statistical considerations are important when analyzing multi-omics data related to POPTRDRAFT_834139?

When analyzing multi-omics data:

  • Sample Size and Power:

    • Ensure sufficient biological replicates (minimum n=3, preferable n≥5)

    • Perform power analysis to determine sample size needed for detecting effects

    • Consider nested experimental designs to account for biological variation

  • Data Integration Methods:

    • Use network-based Lines of Evidence (LOE) approaches to integrate multiple data types

    • Apply appropriate normalization methods for each data type

    • Consider Bayesian integration frameworks for heterogeneous data

  • Multiple Testing Correction:

    • Apply FDR correction (recommended threshold of 0.1) for genome-wide analyses

    • Use procedures like Benjamini-Hochberg for controlling false discovery rate

    • Report both raw and adjusted p-values for transparency

  • Validation Approaches:

    • Cross-validation strategies for predictive models

    • Independent experimental validation of key findings

    • Comparison with published datasets for external validation

For GWAS-based studies involving POPTRDRAFT_834139, researchers should consider both common variant analysis using Linear Mixed Models and rare variant analysis using methods like SKAT as described in the literature .

What quality control measures should be implemented when working with recombinant POPTRDRAFT_834139 protein?

To ensure experimental reproducibility with recombinant protein:

  • Protein Quality Assessment:

    • Verify purity (>90%) using SDS-PAGE

    • Confirm identity by mass spectrometry

    • Assess protein folding using circular dichroism

    • Test batch-to-batch consistency

  • Storage and Handling:

    • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

    • Store working aliquots at 4°C for up to one week

    • Maintain long-term storage at -20°C/-80°C with 50% glycerol

    • Document all storage conditions and durations

  • Functional Verification:

    • Develop and apply functional assays before key experiments

    • Include positive controls from previous successful preparations

    • Verify protein activity before and after experimental timeframes

  • Documentation and Reporting:

    • Record complete reconstitution procedures

    • Document concentration determination methods

    • Report buffer composition in publications

    • Include details on protein production batch in methods sections

Quality Control ParameterAcceptable RangeRecommended Method
Purity>90%SDS-PAGE
Concentration0.1-1.0 mg/mLBradford/BCA assay
BufferTris/PBS-based, pH 8.0pH measurement
Additives6% Trehalose, 5-50% glycerolAs specified

How can researchers apply network biology approaches to understand POPTRDRAFT_834139 function in the context of cell wall regulation?

Network biology approaches offer powerful tools for understanding POPTRDRAFT_834139 function:

  • Constructing Multi-layered Networks:

    • Gene co-expression networks using RNA-seq data with Spearman correlation thresholds of 0.85

    • Gene co-methylation networks using MEDIP-Seq data with correlation thresholds of 0.95

    • Protein-protein interaction networks from yeast two-hybrid or co-immunoprecipitation data

    • SNP correlation networks from genome-wide association studies

  • Network Analysis Methods:

    • Use "anchor" genes with documented roles in cell wall processes to find network connections

    • Calculate LOE scores for genes based on connectivity across multiple network layers

    • Apply network clustering to identify functional modules

    • Perform gene ontology enrichment on network modules

  • Validation Strategies:

    • Cross-reference network predictions with published functional studies

    • Perform targeted experimental validation of high-scoring network connections

    • Compare networks across multiple species to identify conserved features

  • Visualization and Integration:

    • Use Cytoscape or similar tools for network visualization

    • Implement interactive visualizations enabling exploration of different data layers

    • Integrate transcription factor binding site information to identify regulatory relationships

This approach has successfully identified regulatory genes involved in cell wall biosynthesis in Populus trichocarpa, and can be adapted to specifically focus on POPTRDRAFT_834139 and its potential role .

What approaches can be used to investigate the potential role of POPTRDRAFT_834139 in directing lignin deposition?

To investigate POPTRDRAFT_834139's potential role in lignin deposition:

  • Biochemical Interaction Studies:

    • Test for direct interactions with peroxidases that mediate lignin polymerization

    • Assess binding to monolignols or lignin precursors

    • Investigate potential interactions with transporters like ABCG29 that move monolignols to the cell wall

  • Localization and Co-localization:

    • Determine if POPTRDRAFT_834139 co-localizes with sites of lignin deposition

    • Test if POPTRDRAFT_834139 forms stable membrane domains at these sites

    • Measure the temporal relationship between POPTRDRAFT_834139 localization and lignin appearance

  • Genetic Approaches:

    • Use RNA interference or CRISPR-Cas9 to reduce/eliminate POPTRDRAFT_834139 expression

    • Analyze lignin content and composition in modified plants

    • Perform complementation studies in CASP mutant backgrounds

  • Transcriptomics and Network Analysis:

    • Analyze co-expression with known lignin biosynthesis genes

    • Look for common regulatory elements in promoters

    • Examine if POPTRDRAFT_834139 expression corresponds to developmental stages of lignification

Based on studies of related proteins, research should consider that POPTRDRAFT_834139 may influence lignin deposition by recruiting peroxidases and directing the local polymerization of lignin precursors .

What methodological approaches can address the challenges of studying membrane proteins like POPTRDRAFT_834139?

Membrane proteins present unique challenges requiring specialized approaches:

  • Solubilization and Purification Strategies:

    • Test multiple detergents (mild non-ionic, zwitterionic, etc.) for optimal solubilization

    • Consider detergent-free methods using styrene-maleic acid copolymer (SMA)

    • Use nanodiscs or liposomes to maintain native-like lipid environment

    • Optimize buffer conditions to maintain protein stability

  • Structural Studies:

    • Cryo-electron microscopy for structure determination without crystallization

    • Solid-state NMR for structural information in membrane-mimetic environments

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Computational modeling based on homology to other MARVEL family proteins

  • Functional Reconstitution:

    • Liposome reconstitution to test membrane domain formation

    • Giant unilamellar vesicles (GUVs) for visualizing domain dynamics

    • Planar lipid bilayers for electrophysiological measurements if relevant

    • Co-reconstitution with interaction partners to test functional complexes

  • Alternative Expression Systems:

    • Insect cell expression for eukaryotic post-translational modifications

    • Cell-free expression systems with supplied membranes or nanodiscs

    • Yeast expression systems optimized for membrane proteins

    • Mammalian cell expression for complex eukaryotic processing

These approaches can help overcome the intrinsic difficulties of working with four-transmembrane span proteins like POPTRDRAFT_834139 while maintaining their native structure and function.

How can the study of POPTRDRAFT_834139 contribute to broader understanding of membrane domain organization in plants?

The study of POPTRDRAFT_834139 can advance understanding of plant membrane domains by:

  • Comparative Analysis with Known Systems:

    • Compare CASP-like protein membrane domain formation with other plant membrane domains

    • Identify common principles and unique features of different domain types

    • Establish whether POPTRDRAFT_834139 forms domains with characteristics similar to lipid rafts, tetraspanin-enriched microdomains, or other structures

  • Membrane Domain Formation Mechanisms:

    • Investigate if POPTRDRAFT_834139 domains form through protein-protein interactions

    • Assess the role of lipid composition in domain formation and stability

    • Determine if cytoskeletal elements contribute to domain maintenance

  • Functional Consequences of Domain Formation:

    • Examine how POPTRDRAFT_834139 domains affect membrane protein diffusion

    • Test if domains create specialized signaling platforms

    • Investigate if domains participate in vesicle trafficking or endocytosis

  • Evolutionary Perspective:

    • Compare POPTRDRAFT_834139 domain formation with MARVEL family proteins in other organisms

    • Trace the evolution of membrane domain organization across plant lineages

    • Identify when specialized functions like Casparian strip formation emerged

Understanding POPTRDRAFT_834139 function could reveal generalizable principles about how plants organize their plasma membranes into specialized domains for specific cellular functions .

What research gaps currently limit our understanding of POPTRDRAFT_834139 and how might they be addressed?

Current research gaps and potential approaches include:

  • Lack of Direct Functional Characterization:

    • Generate knockout/knockdown lines in Populus trichocarpa using CRISPR-Cas9

    • Perform detailed phenotypic analysis of these lines, focusing on cell wall composition

    • Create overexpression lines to identify gain-of-function phenotypes

  • Limited Knowledge of Interacting Partners:

    • Perform comprehensive protein-protein interaction screens

    • Identify genetic interactions through suppressor/enhancer screens

    • Use proximity labeling approaches (BioID, APEX) to identify proteins in the vicinity

  • Uncertain Subcellular Dynamics:

    • Employ live-cell imaging with photo-switchable fluorescent proteins

    • Track protein movement using single-particle tracking

    • Determine half-life and turnover rates in different cellular contexts

  • Unknown Regulation Mechanisms:

    • Analyze the promoter region for transcription factor binding sites

    • Investigate post-translational regulation through proteomics

    • Examine epigenetic regulation through chromatin immunoprecipitation

Addressing these gaps will require interdisciplinary approaches combining molecular biology, biochemistry, genetics, and advanced imaging technologies.

How might the study of POPTRDRAFT_834139 contribute to lignin engineering in bioenergy applications?

POPTRDRAFT_834139 research could impact lignin engineering through:

  • Targeted Lignin Deposition:

    • If POPTRDRAFT_834139 directs lignin deposition spatially, it could be engineered to modify lignin distribution

    • This could potentially create plants with lignin concentrated in tissues where it's beneficial and reduced where it impedes processing

    • Understanding the mechanism could lead to precision engineering of cell wall architecture

  • Regulatory Network Manipulation:

    • Identifying POPTRDRAFT_834139's position in regulatory networks could reveal key control points

    • These control points could be targeted to modify lignin composition without affecting plant growth

    • Integration with multi-omics data could allow prediction of system-wide effects of modifications

  • Protein Engineering Applications:

    • Structure-function analysis could reveal domains crucial for lignin-related activities

    • These domains could be modified to create variants with enhanced or altered functions

    • Domain swapping between CASP family members might create chimeric proteins with novel properties

  • Biotechnological Tools:

    • POPTRDRAFT_834139-based tools could potentially direct enzyme activities to specific cell wall regions

    • This could enable precise modification of cell wall properties in specific tissues

    • Understanding interaction mechanisms could lead to development of inhibitors or activators for controlled lignification

These applications align with broader goals in Populus research for developing improved bioenergy feedstocks with optimized cell wall properties .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.