POPTRDRAFT_569472 is a transmembrane protein with four membrane-spanning domains, characteristic of CASPs . Its full-length sequence (186 amino acids) includes hydrophilic and hydrophobic regions, enabling integration into lipid bilayers. Key structural features include:
Extracellular loops: Not essential for scaffold formation but may mediate interactions with cell wall-modifying enzymes .
His-tag: Added during recombinant production for purification via affinity chromatography .
| Property | Details |
|---|---|
| Length | 186 amino acids (Full Length, 1–186) |
| UniProt ID | B9I534 |
| Synonyms | Casparian strip membrane protein 6; PtCASP6 |
This protein contributes to:
Casparian Strip Formation: Creates a plasma membrane domain that restricts diffusion, guiding lignin polymerization for water-impermeable barriers in roots .
Cell Wall Modification: Interacts with peroxidases to direct lignin deposition, essential for endodermal cell differentiation .
Membrane Scaffolding: Forms stable domains, acting as a barrier to apoplastic solute transport .
POPTRDRAFT_569472 is expressed in E. coli with optimized protocols to overcome challenges like hydrophobicity and rare codons . Key production parameters:
| Parameter | Specification |
|---|---|
| Host | E. coli |
| Purity | >90% (SDS-PAGE validated) |
| Form | Lyophilized powder (stored at -20°C/-80°C) |
| Amino Acid Sequence | MKAGPIELGEGKSSAPKAAVNRGVAILDFILRILAFIGTLGSAISMATTNETLPFFTQFI... |
Expression Efficiency: Transmembrane proteins often face solubility issues in prokaryotic systems, requiring codon optimization or fusion tags .
Purification: His-tag affinity chromatography ensures high purity, avoiding truncation or degradation .
Functional Studies:
Structural Analysis:
Biotechnological Applications:
Stress Resistance: Engineering root systems with enhanced Casparian strip proteins for drought tolerance.
Biomaterials: Leveraging scaffold-forming properties in synthetic membrane design.
Unresolved Questions:
Regulation: How post-translational modifications affect POPTRDRAFT_569472 stability.
Ecological Impact: Role in nutrient cycling and microbial interactions in soils.
KEGG: pop:POPTR_0012s01320g
STRING: 3694.POPTR_0012s01320.1
POPTRDRAFT_569472 is a Casparian strip membrane protein identified in Populus trichocarpa (Western balsam poplar, also known as Populus balsamifera subsp. trichocarpa). This protein belongs to the CASP (Casparian Strip Membrane Domain Proteins) family, which are four-membrane-span proteins that play critical roles in plant biology. The primary functions of these proteins include:
Formation of membrane scaffolds that create diffusion barriers in the plasma membrane
Mediation of Casparian strip deposition in the endodermis
Recruitment of lignin polymerization machinery
Direction of local cell wall modifications
POPTRDRAFT_569472 specifically demonstrates high stability in its membrane domain, exhibiting the hallmarks of a membrane scaffold. This protein contributes to the formation of a membrane fence in the endodermis that restricts the diffusion of molecules between cellular compartments. Additionally, it interacts with secreted peroxidases to facilitate lignin deposition and Casparian strip formation .
To study this protein's role effectively, researchers should employ both in vitro biochemical assays and in vivo localization studies to understand its dual functions in membrane organization and cell wall modification.
POPTRDRAFT_569472 is part of the broader CASP-like (CASPL) protein family that has been identified throughout the plant kingdom. The relationship between this specific protein and other CASP family members reveals important evolutionary and functional connections:
Evolutionary conservation: CASPL proteins have been found in all major divisions of land plants as well as green algae, indicating their ancient evolutionary origin and fundamental importance in plant biology .
Structural similarities: Like other CASPs, POPTRDRAFT_569472 contains four transmembrane domains with conserved residues primarily located in these transmembrane regions .
Functional homology: Most CASPLs share with CASPs the ability to integrate into membrane domains when expressed ectopically, suggesting a common propensity to form transmembrane scaffolds .
Homology beyond plants: CASPLs have homologs outside the plant kingdom, identified as members of the MARVEL protein family, indicating a deep evolutionary conservation of this protein structure and potentially some aspects of its function .
Subfamily differentiation: Within the CASPL family, proteins are categorized into subfamilies based on sequence similarity and functional specialization, with POPTRDRAFT_569472 occupying a specific position in this evolutionary tree.
To investigate these relationships thoroughly, researchers should employ phylogenetic analysis tools combined with functional assays to determine which properties are shared across family members and which are specific to POPTRDRAFT_569472.
Studying POPTRDRAFT_569472 function requires a multi-faceted experimental approach that addresses both its membrane scaffolding and cell wall modification roles. Based on research methodologies employed for related proteins, the following experimental approaches are recommended:
Localization studies:
Protein-protein interaction analysis:
Yeast two-hybrid screening to identify interaction partners
Co-immunoprecipitation to confirm in vivo interactions
BiFC (Bimolecular Fluorescence Complementation) to visualize interactions in plant cells
Pull-down assays with recombinant protein to identify binding partners, particularly peroxidases involved in lignin deposition
Functional analysis:
Biochemical characterization:
Recombinant protein expression and purification
In vitro lignification assays to assess cell wall modification function
Membrane extraction and fractionation to study protein association with membrane domains
When designing these experiments, researchers should consider the following factors:
The research objective and whether they are studying the membrane scaffolding function, cell wall modification, or both
The need for appropriate controls, including related CASP proteins
The sample size required for statistical significance
Producing and purifying recombinant POPTRDRAFT_569472 presents specific challenges due to its membrane-embedded nature. A methodological approach should include:
Expression system selection:
Bacterial systems (E. coli): Most economical but may require optimization for membrane proteins
Yeast systems (P. pastoris): Better for eukaryotic membrane proteins with post-translational modifications
Insect cell systems: Excellent for complex eukaryotic proteins but more expensive
Plant-based expression systems: Most native-like environment but potentially lower yields
Construct design considerations:
Addition of affinity tags (His6, GST, MBP) for purification, preferably with a cleavable linker
Fusion partners to enhance solubility (e.g., SUMO, Trx)
Codon optimization for the chosen expression system
Signal sequences for proper membrane targeting
Expression optimization:
Temperature adjustment (typically lower temperatures for membrane proteins)
Induction conditions (concentration and timing)
Use of specialized E. coli strains (e.g., C41/C43) designed for membrane protein expression
Supplementation with extra chaperones
Purification protocol:
Membrane isolation through ultracentrifugation
Solubilization using appropriate detergents (DDM, LDAO, or similar)
Affinity chromatography utilizing engineered tags
Size exclusion chromatography for final polishing
Quality control assessments:
SDS-PAGE and Western blotting to confirm identity and purity
Mass spectrometry for accurate mass determination
Circular dichroism to assess secondary structure
Dynamic light scattering to evaluate homogeneity
Available commercial recombinant POPTRDRAFT_569472 is typically supplied at concentrations of 50 μg per vial in a Tris-based buffer with 50% glycerol that has been optimized for protein stability . For long-term storage, maintaining the protein at -20°C or -80°C is recommended, with working aliquots kept at 4°C for up to one week to avoid repeated freeze-thaw cycles .
Visualizing POPTRDRAFT_569472 localization requires techniques that provide high spatial resolution while preserving the native context of the protein. Based on successful approaches with related CASP proteins, the following methods are recommended:
Transgenic expression with fluorescent protein tags:
C-terminal or N-terminal GFP/YFP/mCherry fusions
Photoconvertible fluorescent proteins (e.g., mEos) for super-resolution approaches
Split fluorescent protein systems for detecting protein-protein interactions in situ
Immunohistochemical approaches:
Generation of specific antibodies against POPTRDRAFT_569472
Tissue fixation and sectioning optimized for membrane protein preservation
Fluorescent secondary antibodies for confocal microscopy
Gold-conjugated antibodies for transmission electron microscopy
Advanced microscopy techniques:
Confocal laser scanning microscopy for 3D localization
TIRF (Total Internal Reflection Fluorescence) microscopy for detailed plasma membrane visualization
FRAP to assess protein mobility within membranes
STORM/PALM super-resolution microscopy for nanoscale localization
Correlative approaches:
Combining fluorescence imaging with electron microscopy
Live-cell imaging followed by fixation and immunolabeling
Combining protein localization with cell wall staining (e.g., lignin-specific stains)
Data collection and analysis considerations:
Image multiple independent transgenic lines to rule out position effects
Use appropriate controls (other membrane proteins, free fluorescent protein)
Quantify fluorescence intensity along membrane domains
Perform time-lapse imaging to capture dynamic processes
These visualization methods should be selected based on the specific research question, available equipment, and whether the focus is on subcellular localization, dynamics, or protein-protein interactions at the membrane domain.
Investigating POPTRDRAFT_569472 function in vivo presents several significant challenges that researchers must address through careful experimental design:
Genetic redundancy issues:
Multiple CASP/CASPL family members may have overlapping functions
Knockout of single genes might not produce visible phenotypes due to functional compensation
Solution approach: Generate higher-order mutants or employ inducible dominant-negative constructs
Developmental timing concerns:
CASPL proteins may function at specific developmental stages
Expression might be transient or tissue-specific
Solution approach: Use stage-specific promoters or inducible systems for temporal control of gene manipulation
Technical difficulties in imaging:
Membrane proteins require special fixation and embedding protocols
Maintaining membrane structure during sample preparation is challenging
Solution approach: Optimize tissue preparation methods specifically for membrane visualization; use cryofixation techniques
Functional assessment challenges:
Separating the two functions (membrane scaffold formation vs. cell wall modification) is difficult
Measuring barrier function requires specialized permeability assays
Solution approach: Develop specific assays for each function; use mutants that affect only one function
Transformation barriers:
Populus transformation is more challenging than model plants like Arabidopsis
Long generation time complicates genetic studies
Solution approach: Use heterologous systems or CRISPR-based approaches for faster results
Protein-protein interaction complexity:
CASP proteins form complexes with multiple partners
Interactions may be transient or depend on specific conditions
Solution approach: Employ proximity labeling techniques (BioID, APEX) to capture the full interactome
A comprehensive experimental design would address these challenges by combining multiple approaches, including heterologous expression studies, complementation analyses, and comparative studies with better-characterized CASP family members from model species.
Reconciling contradictory findings is a common challenge in scientific research, particularly when studying complex proteins like POPTRDRAFT_569472 that have multiple functions. A methodological approach to addressing contradictions includes:
Systematic analysis of experimental conditions:
Compare expression systems used (heterologous vs. native)
Examine differences in experimental conditions (temperature, pH, ionic strength)
Assess protein tags and fusion partners that might affect function
Create a comparative table of methodologies across studies to identify critical variables
Functional domain analysis:
Context-dependent function assessment:
Investigate tissue-specific differences in function
Examine developmental stage variations
Consider environmental influences on protein function
Data integration approaches:
Meta-analysis of published findings
Bayesian approaches to weigh evidence from different studies
Collaborative experimentation across multiple laboratories
Addressing potential confounding variables:
Post-translational modifications that might differ between systems
Presence/absence of interaction partners
Differences in measurement techniques or endpoints
When examining contradictions in the literature, researchers should apply a structured approach as outlined in contradiction analysis frameworks . This includes categorizing the type of contradiction (direct statement contradiction, numerical value discrepancy, or inferential contradiction), evaluating the strength of evidence supporting each finding, and determining if the contradictions are apparent or actual.
A thorough analysis might reveal that apparent contradictions are actually compatible observations of different aspects of POPTRDRAFT_569472 function under different conditions or in different contexts.
Comparative analysis of POPTRDRAFT_569472 homologs across different plant species offers valuable insights into functional conservation, evolutionary adaptation, and specialization. This approach can reveal:
Evolutionary trajectory of CASP proteins:
Identification of core conserved functions vs. species-specific adaptations
Correlation between protein structure variations and environmental adaptations
Tracing the emergence of specialized functions in different plant lineages
Structure-function relationships:
Identification of highly conserved residues crucial for core functions
Detection of rapidly evolving regions that may confer species-specific functions
Correlation between sequence changes and functional differences
Expression pattern conservation:
Comparison of tissue-specific expression across species
Identification of conserved regulatory elements in promoter regions
Analysis of expression responses to environmental stresses across species
Methodological framework for comparative analysis:
Phylogenetic analysis to establish evolutionary relationships
Sequence alignment and conservation scoring
Homology modeling of protein structures
Heterologous expression studies to test functional equivalence
Cross-species complementation experiments
Data integration through comparative genomics:
Analysis of chromosomal context and synteny
Examination of gene family expansion/contraction events
Investigation of selection pressures through dN/dS analysis
The comparative approach is particularly valuable because CASPL proteins have been identified in all major divisions of land plants as well as green algae . This wide distribution enables researchers to track how these proteins have evolved and adapted across diverse plant lineages with different physiological needs and environmental adaptations.
For example, comparing POPTRDRAFT_569472 from a woody perennial like Populus with homologs from herbaceous annuals, monocots, or early diverging plant lineages could reveal how CASP protein functions have specialized during plant evolution to accommodate different growth habits, vascular architectures, and environmental challenges.