Recombinant Populus trichocarpa Casparian strip membrane protein POPTRDRAFT_569472 (POPTRDRAFT_569472)

Shipped with Ice Packs
In Stock

Description

Protein Structure

POPTRDRAFT_569472 is a transmembrane protein with four membrane-spanning domains, characteristic of CASPs . Its full-length sequence (186 amino acids) includes hydrophilic and hydrophobic regions, enabling integration into lipid bilayers. Key structural features include:

  • Extracellular loops: Not essential for scaffold formation but may mediate interactions with cell wall-modifying enzymes .

  • His-tag: Added during recombinant production for purification via affinity chromatography .

PropertyDetails
Length186 amino acids (Full Length, 1–186)
UniProt IDB9I534
SynonymsCasparian strip membrane protein 6; PtCASP6

Biological Function

This protein contributes to:

  1. Casparian Strip Formation: Creates a plasma membrane domain that restricts diffusion, guiding lignin polymerization for water-impermeable barriers in roots .

  2. Cell Wall Modification: Interacts with peroxidases to direct lignin deposition, essential for endodermal cell differentiation .

  3. Membrane Scaffolding: Forms stable domains, acting as a barrier to apoplastic solute transport .

Recombinant Production

POPTRDRAFT_569472 is expressed in E. coli with optimized protocols to overcome challenges like hydrophobicity and rare codons . Key production parameters:

ParameterSpecification
HostE. coli
Purity>90% (SDS-PAGE validated)
FormLyophilized powder (stored at -20°C/-80°C)
Amino Acid SequenceMKAGPIELGEGKSSAPKAAVNRGVAILDFILRILAFIGTLGSAISMATTNETLPFFTQFI...

Biochemical Challenges

  • Expression Efficiency: Transmembrane proteins often face solubility issues in prokaryotic systems, requiring codon optimization or fusion tags .

  • Purification: His-tag affinity chromatography ensures high purity, avoiding truncation or degradation .

Experimental Uses

  1. Functional Studies:

    • Membrane Domain Formation: Experiments in heterologous systems (e.g., Arabidopsis) test localization and barrier integrity .

    • Protein Interactions: Co-immunoprecipitation identifies binding partners like lignin-modifying peroxidases .

  2. Structural Analysis:

    • X-ray Crystallography: Resolves transmembrane domain interactions critical for scaffold stability .

Key Research Insights

StudyFindingsSource
CASPs in EndodermisPOPTRDRAFT_569472-like proteins mediate lignin deposition via peroxidase interactions .
Evolutionary RoleCASPs emerged with land plants, correlating with Casparian strip development .
Recombinant UtilityHis-tagged versions enable in vitro assays for membrane protein dynamics .

CASPs vs. CASPLs

FeatureCASPsCASPLs (CASPs-like)
FunctionLignin deposition barrierPotential scaffold formation
LocalizationEndodermal CSDVariable (ectopic expression)
Evolutionary OriginPlant-specificMARVEL family homologs (non-plant)

Future Directions

  1. Biotechnological Applications:

    • Stress Resistance: Engineering root systems with enhanced Casparian strip proteins for drought tolerance.

    • Biomaterials: Leveraging scaffold-forming properties in synthetic membrane design.

  2. Unresolved Questions:

    • Regulation: How post-translational modifications affect POPTRDRAFT_569472 stability.

    • Ecological Impact: Role in nutrient cycling and microbial interactions in soils.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
POPTRDRAFT_569472; Casparian strip membrane protein 6; PtCASP6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Target Names
POPTRDRAFT_569472
Target Protein Sequence
MKAGPIELGEGKSSAPKAAVNRGVAILDFILRILAFIGTLGSAISMATTNETLPFFTQFI RFRAEYDDLPTFTFFVVANGVVSAYLLFSLPFSIFNIVRSKAQNSRILLIILDTAMLGLL SAGASAAAAIVYLAHQGNVRTNWSAICQQFNSFCERISGSLIGSFIGVVVFILLISLSAV ALSRHK
Uniprot No.

Target Background

Function
This protein plays a crucial role in regulating membrane-cell wall junctions and localized cell wall deposition. It is essential for the establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips. Casparian strips are a specialized cell wall modification of the root endodermis that acts as an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm, preventing lateral diffusion.
Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is POPTRDRAFT_569472 and what is its role in plants?

POPTRDRAFT_569472 is a Casparian strip membrane protein identified in Populus trichocarpa (Western balsam poplar, also known as Populus balsamifera subsp. trichocarpa). This protein belongs to the CASP (Casparian Strip Membrane Domain Proteins) family, which are four-membrane-span proteins that play critical roles in plant biology. The primary functions of these proteins include:

  • Formation of membrane scaffolds that create diffusion barriers in the plasma membrane

  • Mediation of Casparian strip deposition in the endodermis

  • Recruitment of lignin polymerization machinery

  • Direction of local cell wall modifications

POPTRDRAFT_569472 specifically demonstrates high stability in its membrane domain, exhibiting the hallmarks of a membrane scaffold. This protein contributes to the formation of a membrane fence in the endodermis that restricts the diffusion of molecules between cellular compartments. Additionally, it interacts with secreted peroxidases to facilitate lignin deposition and Casparian strip formation .

To study this protein's role effectively, researchers should employ both in vitro biochemical assays and in vivo localization studies to understand its dual functions in membrane organization and cell wall modification.

How does POPTRDRAFT_569472 relate to other CASP family proteins?

POPTRDRAFT_569472 is part of the broader CASP-like (CASPL) protein family that has been identified throughout the plant kingdom. The relationship between this specific protein and other CASP family members reveals important evolutionary and functional connections:

  • Evolutionary conservation: CASPL proteins have been found in all major divisions of land plants as well as green algae, indicating their ancient evolutionary origin and fundamental importance in plant biology .

  • Structural similarities: Like other CASPs, POPTRDRAFT_569472 contains four transmembrane domains with conserved residues primarily located in these transmembrane regions .

  • Functional homology: Most CASPLs share with CASPs the ability to integrate into membrane domains when expressed ectopically, suggesting a common propensity to form transmembrane scaffolds .

  • Homology beyond plants: CASPLs have homologs outside the plant kingdom, identified as members of the MARVEL protein family, indicating a deep evolutionary conservation of this protein structure and potentially some aspects of its function .

  • Subfamily differentiation: Within the CASPL family, proteins are categorized into subfamilies based on sequence similarity and functional specialization, with POPTRDRAFT_569472 occupying a specific position in this evolutionary tree.

To investigate these relationships thoroughly, researchers should employ phylogenetic analysis tools combined with functional assays to determine which properties are shared across family members and which are specific to POPTRDRAFT_569472.

What experimental approaches are best suited for studying POPTRDRAFT_569472 function?

Studying POPTRDRAFT_569472 function requires a multi-faceted experimental approach that addresses both its membrane scaffolding and cell wall modification roles. Based on research methodologies employed for related proteins, the following experimental approaches are recommended:

  • Localization studies:

    • Fluorescent protein tagging (e.g., GFP fusion) to visualize protein localization in live cells

    • Immunolocalization with specific antibodies for higher resolution imaging

    • FRAP (Fluorescence Recovery After Photobleaching) to measure protein mobility and stability in the membrane domain

  • Protein-protein interaction analysis:

    • Yeast two-hybrid screening to identify interaction partners

    • Co-immunoprecipitation to confirm in vivo interactions

    • BiFC (Bimolecular Fluorescence Complementation) to visualize interactions in plant cells

    • Pull-down assays with recombinant protein to identify binding partners, particularly peroxidases involved in lignin deposition

  • Functional analysis:

    • Gene knockout/knockdown using CRISPR-Cas9 or RNAi

    • Complementation studies with wild-type and mutated versions

    • Ectopic expression in heterologous systems to assess scaffold formation capacity

    • Barrier function tests using fluorescent tracers to assess membrane domain integrity

  • Biochemical characterization:

    • Recombinant protein expression and purification

    • In vitro lignification assays to assess cell wall modification function

    • Membrane extraction and fractionation to study protein association with membrane domains

When designing these experiments, researchers should consider the following factors:

  • The research objective and whether they are studying the membrane scaffolding function, cell wall modification, or both

  • The need for appropriate controls, including related CASP proteins

  • The sample size required for statistical significance

  • Time constraints and available resources

How can recombinant POPTRDRAFT_569472 be produced and purified for structural and functional studies?

Producing and purifying recombinant POPTRDRAFT_569472 presents specific challenges due to its membrane-embedded nature. A methodological approach should include:

  • Expression system selection:

    • Bacterial systems (E. coli): Most economical but may require optimization for membrane proteins

    • Yeast systems (P. pastoris): Better for eukaryotic membrane proteins with post-translational modifications

    • Insect cell systems: Excellent for complex eukaryotic proteins but more expensive

    • Plant-based expression systems: Most native-like environment but potentially lower yields

  • Construct design considerations:

    • Addition of affinity tags (His6, GST, MBP) for purification, preferably with a cleavable linker

    • Fusion partners to enhance solubility (e.g., SUMO, Trx)

    • Codon optimization for the chosen expression system

    • Signal sequences for proper membrane targeting

  • Expression optimization:

    • Temperature adjustment (typically lower temperatures for membrane proteins)

    • Induction conditions (concentration and timing)

    • Use of specialized E. coli strains (e.g., C41/C43) designed for membrane protein expression

    • Supplementation with extra chaperones

  • Purification protocol:

    • Membrane isolation through ultracentrifugation

    • Solubilization using appropriate detergents (DDM, LDAO, or similar)

    • Affinity chromatography utilizing engineered tags

    • Size exclusion chromatography for final polishing

  • Quality control assessments:

    • SDS-PAGE and Western blotting to confirm identity and purity

    • Mass spectrometry for accurate mass determination

    • Circular dichroism to assess secondary structure

    • Dynamic light scattering to evaluate homogeneity

Available commercial recombinant POPTRDRAFT_569472 is typically supplied at concentrations of 50 μg per vial in a Tris-based buffer with 50% glycerol that has been optimized for protein stability . For long-term storage, maintaining the protein at -20°C or -80°C is recommended, with working aliquots kept at 4°C for up to one week to avoid repeated freeze-thaw cycles .

What methods are effective for visualizing POPTRDRAFT_569472 localization in plant tissues?

Visualizing POPTRDRAFT_569472 localization requires techniques that provide high spatial resolution while preserving the native context of the protein. Based on successful approaches with related CASP proteins, the following methods are recommended:

  • Transgenic expression with fluorescent protein tags:

    • C-terminal or N-terminal GFP/YFP/mCherry fusions

    • Photoconvertible fluorescent proteins (e.g., mEos) for super-resolution approaches

    • Split fluorescent protein systems for detecting protein-protein interactions in situ

  • Immunohistochemical approaches:

    • Generation of specific antibodies against POPTRDRAFT_569472

    • Tissue fixation and sectioning optimized for membrane protein preservation

    • Fluorescent secondary antibodies for confocal microscopy

    • Gold-conjugated antibodies for transmission electron microscopy

  • Advanced microscopy techniques:

    • Confocal laser scanning microscopy for 3D localization

    • TIRF (Total Internal Reflection Fluorescence) microscopy for detailed plasma membrane visualization

    • FRAP to assess protein mobility within membranes

    • STORM/PALM super-resolution microscopy for nanoscale localization

  • Correlative approaches:

    • Combining fluorescence imaging with electron microscopy

    • Live-cell imaging followed by fixation and immunolabeling

    • Combining protein localization with cell wall staining (e.g., lignin-specific stains)

Data collection and analysis considerations:

  • Image multiple independent transgenic lines to rule out position effects

  • Use appropriate controls (other membrane proteins, free fluorescent protein)

  • Quantify fluorescence intensity along membrane domains

  • Perform time-lapse imaging to capture dynamic processes

These visualization methods should be selected based on the specific research question, available equipment, and whether the focus is on subcellular localization, dynamics, or protein-protein interactions at the membrane domain.

What are the challenges in studying POPTRDRAFT_569472 function in vivo?

Investigating POPTRDRAFT_569472 function in vivo presents several significant challenges that researchers must address through careful experimental design:

  • Genetic redundancy issues:

    • Multiple CASP/CASPL family members may have overlapping functions

    • Knockout of single genes might not produce visible phenotypes due to functional compensation

    • Solution approach: Generate higher-order mutants or employ inducible dominant-negative constructs

  • Developmental timing concerns:

    • CASPL proteins may function at specific developmental stages

    • Expression might be transient or tissue-specific

    • Solution approach: Use stage-specific promoters or inducible systems for temporal control of gene manipulation

  • Technical difficulties in imaging:

    • Membrane proteins require special fixation and embedding protocols

    • Maintaining membrane structure during sample preparation is challenging

    • Solution approach: Optimize tissue preparation methods specifically for membrane visualization; use cryofixation techniques

  • Functional assessment challenges:

    • Separating the two functions (membrane scaffold formation vs. cell wall modification) is difficult

    • Measuring barrier function requires specialized permeability assays

    • Solution approach: Develop specific assays for each function; use mutants that affect only one function

  • Transformation barriers:

    • Populus transformation is more challenging than model plants like Arabidopsis

    • Long generation time complicates genetic studies

    • Solution approach: Use heterologous systems or CRISPR-based approaches for faster results

  • Protein-protein interaction complexity:

    • CASP proteins form complexes with multiple partners

    • Interactions may be transient or depend on specific conditions

    • Solution approach: Employ proximity labeling techniques (BioID, APEX) to capture the full interactome

A comprehensive experimental design would address these challenges by combining multiple approaches, including heterologous expression studies, complementation analyses, and comparative studies with better-characterized CASP family members from model species.

How can contradictory findings about POPTRDRAFT_569472 function be reconciled?

Reconciling contradictory findings is a common challenge in scientific research, particularly when studying complex proteins like POPTRDRAFT_569472 that have multiple functions. A methodological approach to addressing contradictions includes:

  • Systematic analysis of experimental conditions:

    • Compare expression systems used (heterologous vs. native)

    • Examine differences in experimental conditions (temperature, pH, ionic strength)

    • Assess protein tags and fusion partners that might affect function

    • Create a comparative table of methodologies across studies to identify critical variables

  • Functional domain analysis:

    • Determine if contradictions relate to specific protein domains

    • Use domain swapping or chimeric proteins to identify functional regions

    • Test if the two functions (membrane scaffolding and cell wall modification) can be uncoupled, as has been demonstrated for some CASP proteins

  • Context-dependent function assessment:

    • Investigate tissue-specific differences in function

    • Examine developmental stage variations

    • Consider environmental influences on protein function

  • Data integration approaches:

    • Meta-analysis of published findings

    • Bayesian approaches to weigh evidence from different studies

    • Collaborative experimentation across multiple laboratories

  • Addressing potential confounding variables:

    • Post-translational modifications that might differ between systems

    • Presence/absence of interaction partners

    • Differences in measurement techniques or endpoints

When examining contradictions in the literature, researchers should apply a structured approach as outlined in contradiction analysis frameworks . This includes categorizing the type of contradiction (direct statement contradiction, numerical value discrepancy, or inferential contradiction), evaluating the strength of evidence supporting each finding, and determining if the contradictions are apparent or actual.

A thorough analysis might reveal that apparent contradictions are actually compatible observations of different aspects of POPTRDRAFT_569472 function under different conditions or in different contexts.

What novel insights can comparative analysis of POPTRDRAFT_569472 across different plant species provide?

Comparative analysis of POPTRDRAFT_569472 homologs across different plant species offers valuable insights into functional conservation, evolutionary adaptation, and specialization. This approach can reveal:

  • Evolutionary trajectory of CASP proteins:

    • Identification of core conserved functions vs. species-specific adaptations

    • Correlation between protein structure variations and environmental adaptations

    • Tracing the emergence of specialized functions in different plant lineages

  • Structure-function relationships:

    • Identification of highly conserved residues crucial for core functions

    • Detection of rapidly evolving regions that may confer species-specific functions

    • Correlation between sequence changes and functional differences

  • Expression pattern conservation:

    • Comparison of tissue-specific expression across species

    • Identification of conserved regulatory elements in promoter regions

    • Analysis of expression responses to environmental stresses across species

  • Methodological framework for comparative analysis:

    • Phylogenetic analysis to establish evolutionary relationships

    • Sequence alignment and conservation scoring

    • Homology modeling of protein structures

    • Heterologous expression studies to test functional equivalence

    • Cross-species complementation experiments

  • Data integration through comparative genomics:

    • Analysis of chromosomal context and synteny

    • Examination of gene family expansion/contraction events

    • Investigation of selection pressures through dN/dS analysis

The comparative approach is particularly valuable because CASPL proteins have been identified in all major divisions of land plants as well as green algae . This wide distribution enables researchers to track how these proteins have evolved and adapted across diverse plant lineages with different physiological needs and environmental adaptations.

For example, comparing POPTRDRAFT_569472 from a woody perennial like Populus with homologs from herbaceous annuals, monocots, or early diverging plant lineages could reveal how CASP protein functions have specialized during plant evolution to accommodate different growth habits, vascular architectures, and environmental challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.