Recombinant Populus trichocarpa Casparian strip membrane protein POPTRDRAFT_763057 (POPTRDRAFT_763057)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you require a specific format, please indicate your preference during order placement. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be finalized during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
POPTRDRAFT_763057; Casparian strip membrane protein 1; PtCASP1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Target Names
POPTRDRAFT_763057
Target Protein Sequence
MKSESAAIDIPESSSVAKGKAPLIAVSRNEKGGYRKGIAIFDFILRLAAIATALAAAAAM GTSDETLPFFTQFFQFQASYDDLPTFQFFVIAIAIVGGYLVLSLPFSIVAIVRPHAVGPR LLLIILDAVALTLNTAAGAAAAAIVYLAHNGNSNTNWLAICQQYGDFCQKVSGAVVASFI TVVIFVFLIVLSAFALRRH
Uniprot No.

Target Background

Function
This protein regulates membrane-cell wall junctions and localized cell wall deposition. It plays a crucial role in establishing the Casparian strip membrane domain (CSD) and subsequent formation of Casparian strips. These strips represent a specialized modification of the root endodermis cell wall that creates an apoplastic barrier between the internal apoplasm and the external environment, preventing lateral diffusion.
Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is POPTRDRAFT_763057 and what is its function in Populus trichocarpa?

POPTRDRAFT_763057 is a Casparian strip membrane protein 1 from Populus trichocarpa (Western balsam poplar) that regulates membrane-cell wall junctions and localized cell wall deposition. It is required for the establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, which function as apoplastic barriers between intraorganismal and extraorganismal environments in the root endodermis. This protein plays a critical role in preventing lateral diffusion across this barrier .

What is the molecular structure and key properties of POPTRDRAFT_763057?

POPTRDRAFT_763057 is characterized by the following molecular properties:

PropertyDetails
Length199 amino acids
Molecular Mass21.1 kDa
FamilyCasparian strip membrane proteins (CASP) family
SpeciesPopulus trichocarpa
Primary SequenceMKSESAAIDIPESSSVAKGKAPLIAVSRNEKGGYRKGIAIFDFILRLAAIATALAAAAAMGTSDETLPFFTQFFQFQASYDDLPTFQFFVIAIAIVGGYLVLSLPFSIVAIVRPHAVGPRLLLIILDAVALTLNTAAGAAAAAIVYLAHNGNSNTNWLAICQQYGDFCQKVSGAVVASFITVVIFVFLIVLSAFALRRH

The protein features transmembrane domains typical of Casparian strip membrane proteins with hydrophobic regions that anchor it within the plasma membrane .

How does POPTRDRAFT_763057 relate to other CASP proteins within Populus and across species?

POPTRDRAFT_763057 belongs to the Casparian strip membrane proteins (CASP) family. Phylogenetic analysis shows conservation of CASP proteins across various plant species, with specific orthologs identified in Arabidopsis thaliana (the model system where CASPs have been extensively studied). While POPTRDRAFT_763057 is specific to Populus trichocarpa, its functional homologs exist in other species, showing evolutionary conservation of this important barrier formation mechanism .

In Populus, POPTRDRAFT_763057 has related family members like POPTRDRAFT_873343 (CASP-like protein 5), which serves similar functions in Casparian strip formation but with distinct expression patterns and possibly specialized roles .

What are recommended protocols for recombinant expression and purification of POPTRDRAFT_763057?

For optimal recombinant expression and purification of POPTRDRAFT_763057, the following protocol is recommended:

  • Expression System Selection: E. coli is the preferred heterologous expression system for POPTRDRAFT_763057, as demonstrated with similar membrane proteins .

  • Vector and Tag Design:

    • Use a pET-based expression vector

    • Incorporate an N-terminal 10xHis-tag for purification

    • Include a flexible linker sequence to improve protein folding

  • Expression Conditions:

    • Induce with 0.5-1.0 mM IPTG

    • Culture at lower temperatures (16-18°C) for 16-20 hours to enhance proper folding

    • Use specialized media supplemented with membrane-protein stabilizing agents

  • Purification Protocol:

    • Solubilize membranes with appropriate detergents (DDM or LDAO)

    • Perform immobilized metal affinity chromatography (IMAC)

    • Follow with size exclusion chromatography

    • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Quality Control:

    • Verify purity via SDS-PAGE

    • Confirm identity through Western blotting and mass spectrometry

    • Assess functionality through binding assays

How should researchers design experiments to study POPTRDRAFT_763057 localization and function in planta?

To effectively study POPTRDRAFT_763057 localization and function in planta:

  • Transgenic Approach:

    • Generate fluorescent protein fusions (GFP/YFP) to visualize subcellular localization

    • Create knockout/knockdown lines using CRISPR-Cas9 or RNAi

    • Develop complementation lines expressing the wild-type gene in mutant backgrounds

  • Microscopy Techniques:

    • Use confocal laser scanning microscopy with appropriate staining (propidium iodide for cell walls)

    • Employ transmission electron microscopy to visualize ultrastructural features of the Casparian strip

    • Implement fluorescence recovery after photobleaching (FRAP) to assess protein mobility

  • Functional Assays:

    • Measure apoplastic barrier integrity using tracer dyes (e.g., propidium iodide)

    • Assess ion permeability using radioactive tracers

    • Evaluate root hydraulic conductivity

  • Controls and Variables:

    • Include tissue-specific promoters to restrict expression

    • Use developmental time-course analyses

    • Compare wild-type, mutant, and complemented plants under various stress conditions

What are the key protein-protein interactions of POPTRDRAFT_763057 in Casparian strip formation?

Based on comparative analysis with Arabidopsis CASP proteins, POPTRDRAFT_763057 likely participates in the following protein interaction network:

  • Scaffold Complex Formation:

    • Interacts with other CASP family proteins to form a polymeric platform

    • Recruits lignin biosynthesis enzymes to specific membrane domains

  • Enzyme Recruitment:

    • Interacts with RBOHF (Respiratory Burst Oxidase Homolog F) to generate reactive oxygen species

    • Recruits PER64 (Peroxidase 64) for lignin polymerization

    • Binds ESB1 (Enhanced Suberin 1) for proper Casparian strip formation

  • Regulatory Kinase Interactions:

    • Regulated by SGN1 and SGN3 receptor-like kinases

    • These kinases ensure precise localization of CASP proteins

  • Peptide Signaling:

    • Indirectly influenced by CIFS (Casparian strip integrity factors) small peptides that bind to SGN3

This interaction network ensures spatiotemporal precision in Casparian strip formation, limiting it to the endodermal cell layer in direct contact with the stele .

How is POPTRDRAFT_763057 expression regulated at the transcriptional level?

Transcriptional regulation of POPTRDRAFT_763057, based on homology to Arabidopsis CASP genes, likely involves:

  • Master Transcriptional Regulator:

    • MYB36 transcription factor acts as the primary regulator of CASP gene expression

    • Direct binding of MYB36 to promoter regions activates transcription

  • Upstream Regulatory Pathway:

    • SHORTROOT (SHR) transcription factor, expressed in the stele, moves to endodermis

    • SHR activates SCARECROW (SCR) in the endodermis

    • SCR directly activates MYB36 expression

    • MYB36 subsequently activates POPTRDRAFT_763057 and other CS machinery genes

  • Developmental Timing:

    • Expression is coordinated with root development stages

    • Peak expression occurs prior to visible Casparian strip formation

  • Environmental Response Elements:

    • Promoter likely contains elements responsive to nutrient status

    • Potential regulation by abiotic stress signaling pathways

This multilevel regulation ensures that POPTRDRAFT_763057 is expressed in the correct cell layer at the appropriate developmental stage for proper CS formation .

How can researchers address data contradictions when studying POPTRDRAFT_763057 function across different experimental systems?

When encountering contradictory results related to POPTRDRAFT_763057 function, researchers should:

  • Context Analysis:

    • Carefully analyze experimental contexts in which contradictions arise

    • Compare growth conditions, developmental stages, and genetic backgrounds

    • Examine differences in experimental techniques and materials

  • Systematic Literature Review:

    • Conduct meta-analysis of published findings

    • Identify patterns in contradictory results

    • Determine if contradictions reflect actual biological variation or methodological differences

  • Validation Across Systems:

    • Test protein function in multiple experimental systems

    • Compare heterologous expression results with in planta observations

    • Use complementary techniques to verify findings

  • Targeted Experiments to Resolve Contradictions:

    • Design experiments specifically addressing contradictory points

    • Use genetic approaches (domain swapping, site-directed mutagenesis)

    • Implement controlled environmental conditions to isolate variables

  • Mathematical Modeling:

    • Develop predictive models to reconcile seemingly contradictory data

    • Test hypotheses about context-dependent protein function

A comprehensive approach tracking provenance of data and experimental conditions can help resolve apparent contradictions in POPTRDRAFT_763057 research findings .

What are effective strategies for comparative analysis between POPTRDRAFT_763057 and related CASP proteins in other species?

For effective comparative analysis between POPTRDRAFT_763057 and related CASP proteins:

  • Sequence-Structure-Function Analysis:

    • Perform multiple sequence alignments to identify conserved domains

    • Use homology modeling to predict structural similarities and differences

    • Map functional residues across orthologs

  • Phylogenomic Approaches:

    • Construct comprehensive phylogenetic trees of CASP proteins across species

    • Identify evolutionary patterns and selection pressures

    • Correlate evolutionary distance with functional divergence

  • Heterologous Expression Studies:

    • Express POPTRDRAFT_763057 in Arabidopsis casp mutants

    • Test functional complementation

    • Assess species-specific differences in localization and activity

  • Comparative Expression Analysis:

    • Compare spatiotemporal expression patterns across species

    • Identify conserved and divergent regulatory elements

    • Use RNA-seq data to examine co-expression networks

  • Domain Swapping Experiments:

    • Engineer chimeric proteins with domains from different species

    • Test which domains confer species-specific properties

    • Map functional conservation at the domain level

This approach can reveal both fundamental conserved mechanisms and species-specific adaptations in Casparian strip formation .

How can advanced imaging techniques enhance our understanding of POPTRDRAFT_763057 dynamics?

Advanced imaging techniques that can revolutionize POPTRDRAFT_763057 research include:

  • Super-Resolution Microscopy:

    • STORM (Stochastic Optical Reconstruction Microscopy) can achieve 20 nm resolution

    • PALM (Photoactivated Localization Microscopy) enables precise localization mapping

    • Visualize nanoscale distribution of POPTRDRAFT_763057 within the Casparian strip domain

  • Live-Cell Imaging:

    • Implement fluorescent timer proteins to track protein turnover

    • Use optogenetic tools to manipulate protein function with light

    • Apply FRET (Förster Resonance Energy Transfer) to detect protein-protein interactions

  • 3D Electron Microscopy:

    • FIB-SEM (Focused Ion Beam-Scanning Electron Microscopy) for 3D ultrastructure

    • Correlative Light and Electron Microscopy (CLEM) to connect fluorescence patterns with ultrastructure

    • Immunogold labeling for precise protein localization

  • Advanced Fluorescent Probes:

    • Use environment-sensitive fluorophores to detect membrane microdomain properties

    • Implement split fluorescent proteins to visualize protein assembly

    • Apply fluorescent biosensors to measure local ROS production

These techniques will provide unprecedented insights into the dynamics of POPTRDRAFT_763057 assembly, turnover, and function within the specialized membrane domain of the Casparian strip.

What are the potential applications of CRISPR-Cas9 gene editing for functional studies of POPTRDRAFT_763057?

CRISPR-Cas9 technology offers several powerful approaches for POPTRDRAFT_763057 functional studies:

  • Precise Gene Knockout:

    • Generate complete loss-of-function mutants

    • Create tissue-specific knockouts using cell-type specific promoters

    • Develop multiplexed knockouts of POPTRDRAFT_763057 with related genes

  • Domain-Specific Modifications:

    • Introduce point mutations in functional domains

    • Create truncated versions to identify essential regions

    • Generate domain swaps with other CASP family members

  • Promoter Editing:

    • Modify cis-regulatory elements to alter expression patterns

    • Create reporter gene fusions at the endogenous locus

    • Implement inducible expression systems

  • Base Editing Applications:

    • Introduce specific amino acid changes without double-strand breaks

    • Create conditional alleles through strategic codon modifications

    • Engineer phosphorylation site mutations to study regulation

  • In vivo Tagging:

    • Add fluorescent or epitope tags at the endogenous locus

    • Create split-reporter systems to visualize protein interactions

    • Implement proximity labeling tags for interactome studies

These approaches enable precise manipulation of POPTRDRAFT_763057 in its native genomic context, providing more physiologically relevant insights than traditional overexpression or RNAi approaches.

What are effective troubleshooting strategies for protein expression issues with POPTRDRAFT_763057?

When facing challenges with POPTRDRAFT_763057 expression and purification:

  • Low Expression Yields:

    • Optimize codon usage for the expression host

    • Test multiple expression strains (BL21(DE3), C41(DE3), Rosetta)

    • Reduce expression temperature to 16°C

    • Try different induction conditions (IPTG concentration, induction timing)

    • Consider auto-induction media

  • Protein Insolubility:

    • Screen different detergents for membrane protein extraction

    • Test extraction with increasing detergent concentrations

    • Include stabilizing agents (glycerol, specific lipids)

    • Consider fusion partners that enhance solubility

    • Implement on-column refolding protocols

  • Protein Instability:

    • Optimize buffer composition (pH, salt concentration)

    • Add stabilizing agents (trehalose, glycerol)

    • Test protease inhibitor cocktails

    • Consider rapid purification at 4°C

    • Implement storage in small aliquots to avoid freeze-thaw cycles

  • Purification Challenges:

    • Optimize imidazole concentration in wash and elution buffers

    • Screen multiple chromatography strategies

    • Consider on-column refolding for inclusion bodies

    • Implement quality control at each purification step

Systematic troubleshooting with proper controls can overcome most expression and purification challenges for this membrane protein.

How can researchers effectively design experiments to study POPTRDRAFT_763057 under various environmental stress conditions?

To study POPTRDRAFT_763057 response to environmental stresses:

  • Experimental Design Considerations:

    • Implement factorial designs to test multiple stress factors

    • Include appropriate controls for each stress condition

    • Design time-course experiments to capture dynamic responses

    • Consider dose-response relationships for each stress

    • Ensure sufficient biological and technical replication

  • Stress Application Protocols:

    • Nutrient Stress: Defined media with controlled nutrient omission

    • Salt Stress: Gradual application to avoid osmotic shock

    • Drought Stress: Controlled soil water potential or PEG treatment

    • Heavy Metal Stress: Defined concentrations with consideration of speciation

    • Temperature Stress: Controlled ramping of temperature changes

  • Readout Measurements:

    • Transcript and protein level quantification

    • Protein localization changes via microscopy

    • Casparian strip integrity assays

    • Root physiological measurements

    • Ionomic profiling

  • Data Analysis Approach:

    • Use appropriate statistical models for multifactorial experiments

    • Consider mixed-effects models for time-course data

    • Implement multivariate analysis for complex phenotyping data

This methodological framework enables robust investigation of POPTRDRAFT_763057 function under environmental perturbations relevant to Populus stress adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.