KEGG: pop:POPTR_0006s22510g
STRING: 3694.POPTR_0006s22510.1
POPTRDRAFT_763057 is a Casparian strip membrane protein 1 from Populus trichocarpa (Western balsam poplar) that regulates membrane-cell wall junctions and localized cell wall deposition. It is required for the establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, which function as apoplastic barriers between intraorganismal and extraorganismal environments in the root endodermis. This protein plays a critical role in preventing lateral diffusion across this barrier .
POPTRDRAFT_763057 is characterized by the following molecular properties:
| Property | Details |
|---|---|
| Length | 199 amino acids |
| Molecular Mass | 21.1 kDa |
| Family | Casparian strip membrane proteins (CASP) family |
| Species | Populus trichocarpa |
| Primary Sequence | MKSESAAIDIPESSSVAKGKAPLIAVSRNEKGGYRKGIAIFDFILRLAAIATALAAAAAMGTSDETLPFFTQFFQFQASYDDLPTFQFFVIAIAIVGGYLVLSLPFSIVAIVRPHAVGPRLLLIILDAVALTLNTAAGAAAAAIVYLAHNGNSNTNWLAICQQYGDFCQKVSGAVVASFITVVIFVFLIVLSAFALRRH |
The protein features transmembrane domains typical of Casparian strip membrane proteins with hydrophobic regions that anchor it within the plasma membrane .
POPTRDRAFT_763057 belongs to the Casparian strip membrane proteins (CASP) family. Phylogenetic analysis shows conservation of CASP proteins across various plant species, with specific orthologs identified in Arabidopsis thaliana (the model system where CASPs have been extensively studied). While POPTRDRAFT_763057 is specific to Populus trichocarpa, its functional homologs exist in other species, showing evolutionary conservation of this important barrier formation mechanism .
In Populus, POPTRDRAFT_763057 has related family members like POPTRDRAFT_873343 (CASP-like protein 5), which serves similar functions in Casparian strip formation but with distinct expression patterns and possibly specialized roles .
For optimal recombinant expression and purification of POPTRDRAFT_763057, the following protocol is recommended:
Expression System Selection: E. coli is the preferred heterologous expression system for POPTRDRAFT_763057, as demonstrated with similar membrane proteins .
Vector and Tag Design:
Use a pET-based expression vector
Incorporate an N-terminal 10xHis-tag for purification
Include a flexible linker sequence to improve protein folding
Expression Conditions:
Induce with 0.5-1.0 mM IPTG
Culture at lower temperatures (16-18°C) for 16-20 hours to enhance proper folding
Use specialized media supplemented with membrane-protein stabilizing agents
Purification Protocol:
Quality Control:
Verify purity via SDS-PAGE
Confirm identity through Western blotting and mass spectrometry
Assess functionality through binding assays
To effectively study POPTRDRAFT_763057 localization and function in planta:
Transgenic Approach:
Generate fluorescent protein fusions (GFP/YFP) to visualize subcellular localization
Create knockout/knockdown lines using CRISPR-Cas9 or RNAi
Develop complementation lines expressing the wild-type gene in mutant backgrounds
Microscopy Techniques:
Use confocal laser scanning microscopy with appropriate staining (propidium iodide for cell walls)
Employ transmission electron microscopy to visualize ultrastructural features of the Casparian strip
Implement fluorescence recovery after photobleaching (FRAP) to assess protein mobility
Functional Assays:
Measure apoplastic barrier integrity using tracer dyes (e.g., propidium iodide)
Assess ion permeability using radioactive tracers
Evaluate root hydraulic conductivity
Controls and Variables:
Based on comparative analysis with Arabidopsis CASP proteins, POPTRDRAFT_763057 likely participates in the following protein interaction network:
Scaffold Complex Formation:
Interacts with other CASP family proteins to form a polymeric platform
Recruits lignin biosynthesis enzymes to specific membrane domains
Enzyme Recruitment:
Interacts with RBOHF (Respiratory Burst Oxidase Homolog F) to generate reactive oxygen species
Recruits PER64 (Peroxidase 64) for lignin polymerization
Binds ESB1 (Enhanced Suberin 1) for proper Casparian strip formation
Regulatory Kinase Interactions:
Regulated by SGN1 and SGN3 receptor-like kinases
These kinases ensure precise localization of CASP proteins
Peptide Signaling:
Indirectly influenced by CIFS (Casparian strip integrity factors) small peptides that bind to SGN3
This interaction network ensures spatiotemporal precision in Casparian strip formation, limiting it to the endodermal cell layer in direct contact with the stele .
Transcriptional regulation of POPTRDRAFT_763057, based on homology to Arabidopsis CASP genes, likely involves:
Master Transcriptional Regulator:
MYB36 transcription factor acts as the primary regulator of CASP gene expression
Direct binding of MYB36 to promoter regions activates transcription
Upstream Regulatory Pathway:
SHORTROOT (SHR) transcription factor, expressed in the stele, moves to endodermis
SHR activates SCARECROW (SCR) in the endodermis
SCR directly activates MYB36 expression
MYB36 subsequently activates POPTRDRAFT_763057 and other CS machinery genes
Developmental Timing:
Expression is coordinated with root development stages
Peak expression occurs prior to visible Casparian strip formation
Environmental Response Elements:
Promoter likely contains elements responsive to nutrient status
Potential regulation by abiotic stress signaling pathways
This multilevel regulation ensures that POPTRDRAFT_763057 is expressed in the correct cell layer at the appropriate developmental stage for proper CS formation .
When encountering contradictory results related to POPTRDRAFT_763057 function, researchers should:
Context Analysis:
Carefully analyze experimental contexts in which contradictions arise
Compare growth conditions, developmental stages, and genetic backgrounds
Examine differences in experimental techniques and materials
Systematic Literature Review:
Validation Across Systems:
Test protein function in multiple experimental systems
Compare heterologous expression results with in planta observations
Use complementary techniques to verify findings
Targeted Experiments to Resolve Contradictions:
Design experiments specifically addressing contradictory points
Use genetic approaches (domain swapping, site-directed mutagenesis)
Implement controlled environmental conditions to isolate variables
Mathematical Modeling:
Develop predictive models to reconcile seemingly contradictory data
Test hypotheses about context-dependent protein function
A comprehensive approach tracking provenance of data and experimental conditions can help resolve apparent contradictions in POPTRDRAFT_763057 research findings .
For effective comparative analysis between POPTRDRAFT_763057 and related CASP proteins:
Sequence-Structure-Function Analysis:
Perform multiple sequence alignments to identify conserved domains
Use homology modeling to predict structural similarities and differences
Map functional residues across orthologs
Phylogenomic Approaches:
Construct comprehensive phylogenetic trees of CASP proteins across species
Identify evolutionary patterns and selection pressures
Correlate evolutionary distance with functional divergence
Heterologous Expression Studies:
Express POPTRDRAFT_763057 in Arabidopsis casp mutants
Test functional complementation
Assess species-specific differences in localization and activity
Comparative Expression Analysis:
Compare spatiotemporal expression patterns across species
Identify conserved and divergent regulatory elements
Use RNA-seq data to examine co-expression networks
Domain Swapping Experiments:
Engineer chimeric proteins with domains from different species
Test which domains confer species-specific properties
Map functional conservation at the domain level
This approach can reveal both fundamental conserved mechanisms and species-specific adaptations in Casparian strip formation .
Advanced imaging techniques that can revolutionize POPTRDRAFT_763057 research include:
Super-Resolution Microscopy:
STORM (Stochastic Optical Reconstruction Microscopy) can achieve 20 nm resolution
PALM (Photoactivated Localization Microscopy) enables precise localization mapping
Visualize nanoscale distribution of POPTRDRAFT_763057 within the Casparian strip domain
Live-Cell Imaging:
Implement fluorescent timer proteins to track protein turnover
Use optogenetic tools to manipulate protein function with light
Apply FRET (Förster Resonance Energy Transfer) to detect protein-protein interactions
3D Electron Microscopy:
FIB-SEM (Focused Ion Beam-Scanning Electron Microscopy) for 3D ultrastructure
Correlative Light and Electron Microscopy (CLEM) to connect fluorescence patterns with ultrastructure
Immunogold labeling for precise protein localization
Advanced Fluorescent Probes:
Use environment-sensitive fluorophores to detect membrane microdomain properties
Implement split fluorescent proteins to visualize protein assembly
Apply fluorescent biosensors to measure local ROS production
These techniques will provide unprecedented insights into the dynamics of POPTRDRAFT_763057 assembly, turnover, and function within the specialized membrane domain of the Casparian strip.
CRISPR-Cas9 technology offers several powerful approaches for POPTRDRAFT_763057 functional studies:
Precise Gene Knockout:
Generate complete loss-of-function mutants
Create tissue-specific knockouts using cell-type specific promoters
Develop multiplexed knockouts of POPTRDRAFT_763057 with related genes
Domain-Specific Modifications:
Introduce point mutations in functional domains
Create truncated versions to identify essential regions
Generate domain swaps with other CASP family members
Promoter Editing:
Modify cis-regulatory elements to alter expression patterns
Create reporter gene fusions at the endogenous locus
Implement inducible expression systems
Base Editing Applications:
Introduce specific amino acid changes without double-strand breaks
Create conditional alleles through strategic codon modifications
Engineer phosphorylation site mutations to study regulation
In vivo Tagging:
Add fluorescent or epitope tags at the endogenous locus
Create split-reporter systems to visualize protein interactions
Implement proximity labeling tags for interactome studies
These approaches enable precise manipulation of POPTRDRAFT_763057 in its native genomic context, providing more physiologically relevant insights than traditional overexpression or RNAi approaches.
When facing challenges with POPTRDRAFT_763057 expression and purification:
Low Expression Yields:
Optimize codon usage for the expression host
Test multiple expression strains (BL21(DE3), C41(DE3), Rosetta)
Reduce expression temperature to 16°C
Try different induction conditions (IPTG concentration, induction timing)
Consider auto-induction media
Protein Insolubility:
Screen different detergents for membrane protein extraction
Test extraction with increasing detergent concentrations
Include stabilizing agents (glycerol, specific lipids)
Consider fusion partners that enhance solubility
Implement on-column refolding protocols
Protein Instability:
Purification Challenges:
Optimize imidazole concentration in wash and elution buffers
Screen multiple chromatography strategies
Consider on-column refolding for inclusion bodies
Implement quality control at each purification step
Systematic troubleshooting with proper controls can overcome most expression and purification challenges for this membrane protein.
To study POPTRDRAFT_763057 response to environmental stresses:
Experimental Design Considerations:
Stress Application Protocols:
Nutrient Stress: Defined media with controlled nutrient omission
Salt Stress: Gradual application to avoid osmotic shock
Drought Stress: Controlled soil water potential or PEG treatment
Heavy Metal Stress: Defined concentrations with consideration of speciation
Temperature Stress: Controlled ramping of temperature changes
Readout Measurements:
Transcript and protein level quantification
Protein localization changes via microscopy
Casparian strip integrity assays
Root physiological measurements
Ionomic profiling
Data Analysis Approach:
Use appropriate statistical models for multifactorial experiments
Consider mixed-effects models for time-course data
Implement multivariate analysis for complex phenotyping data
This methodological framework enables robust investigation of POPTRDRAFT_763057 function under environmental perturbations relevant to Populus stress adaptation.