Recombinant Populus trichocarpa Casparian strip membrane protein POPTRDRAFT_767048 (POPTRDRAFT_767048)

Shipped with Ice Packs
In Stock

Description

Recombinant Production

Expression System:

  • Host: E. coli

  • Tag: N-terminal His-tag for purification

  • Purity: >90% (SDS-PAGE verified)

Biological Role:

  • Directs Casparian strip formation by scaffolding membrane-cell wall junctions .

  • Recruits lignin polymerization machinery to create apoplastic barriers in root endodermis .

  • Restricts lateral diffusion of solutes and pathogens .

Mechanistic Studies:

  • CASP proteins form stable membrane domains that exclude other transporters (e.g., NOD26-LIKE INTRINSIC PROTEIN5;1) .

  • Truncated inverted repeats in related genes may regulate RNA-directed DNA methylation .

Quality Control Considerations

  • Contamination risks in recombinant proteins (e.g., IL-4 in IL-17F preparations ) highlight the need for:

    • Multi-supplier validation .

    • Western blot or mass spectrometry verification .

  • Stability: Avoid repeated freeze-thaw cycles; working aliquots stable at 4°C for one week .

Comparative Analysis with Related Proteins

FeaturePOPTRDRAFT_767048 POPTRDRAFT_569472
Gene IDPOPTRDRAFT_767048POPTRDRAFT_569472
Protein Length243 aaNot specified
Host SystemE. coliE. coli, yeast, or mammalian cells
Purity>90%>90%
Functional AnnotationCASP4Hypothetical protein

Research Applications

  • Membrane Domain Studies: Investigating CASP-mediated plasma membrane scaffolding .

  • Evolutionary Biology: CASPL proteins in land plants share structural motifs with animal MARVEL proteins .

  • Agricultural Biotechnology: Engineering root barriers for stress tolerance .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag if possible.
Synonyms
POPTRDRAFT_767048; Casparian strip membrane protein 4; PtCASP4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-243
Protein Length
full length protein
Species
Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Target Names
POPTRDRAFT_767048
Target Protein Sequence
MNPIYINHILPWHSITNKLSSPDHYLLAMDVSDKSGEATKITIQEPKADTKGKGIAGALT APVVVAAKAAQRPRKGWKKGAAIFDLTLRLSAIAAGFAATSLMATTDQTLPFFTQFFQFH AQYTDLPTFLSFMIVNAITSGYLVLSLPFSIVCIVRARAAGPRLLLIILDSVMMALTTSA ASASAAIVYLAHNGNSSSNWNAFCQQFNNYCQQVSNAVVASFLAAALLLSLVVLSAFALR KMK
Uniprot No.

Target Background

Function
Regulates membrane-cell wall junctions and localized cell wall deposition. Required for establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis. This modification acts as an apoplastic barrier between the intraorganismal and extraorganismal apoplasm, preventing lateral diffusion.
Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is POPTRDRAFT_767048 and what is its biological function?

POPTRDRAFT_767048 (also known as PtCASP4) is a Casparian strip membrane protein found in Populus trichocarpa. It belongs to the family of CASPARIAN STRIP MEMBRANE DOMAIN PROTEINS (CASPs) that are four-membrane-span proteins mediating the deposition of Casparian strips in the endodermis by recruiting the lignin polymerization machinery . These proteins show high stability in their membrane domain, which presents all the hallmarks of a membrane scaffold . The primary biological functions of CASPs include forming membrane scaffolds and directing cell wall modifications, particularly the deposition of lignin in Casparian strips . These two activities can be uncoupled, as formation of the CASP domain is independent from lignin deposition, and interactions between CASPs and peroxidases can occur outside the Casparian strip membrane domain (CSD) when CASPs are ectopically expressed .

How is POPTRDRAFT_767048 classified within the plant genome?

POPTRDRAFT_767048 is classified as a protein-coding gene in the Populus trichocarpa (black cottonwood) genome . It has been annotated with the gene symbol LOC7478575 and Entrez Gene ID 7478575 . Interestingly, this gene has been described both as a "hypothetical protein" in earlier annotations and as a "casparian strip membrane protein 4" in more recent classifications . The gene belongs to the broader family of CASP and CASP-like (CASPL) proteins found across land plants and green algae . Within this classification, POPTRDRAFT_767048 specifically belongs to the CASP subfamily, which is distinguished by specific protein signatures that emerged with the appearance of Casparian strips in the plant kingdom .

What expression systems are optimal for producing recombinant POPTRDRAFT_767048?

The expression methodology typically involves:

  • Cloning the POPTRDRAFT_767048 gene into an appropriate expression vector

  • Transforming E. coli cells with the construct

  • Inducing protein expression under optimized conditions

  • Cell lysis and protein extraction

  • Purification via His-tag affinity chromatography

For advanced applications requiring post-translational modifications, researchers might consider plant-based expression systems that more closely resemble the native environment of POPTRDRAFT_767048.

What purification strategies yield high-purity POPTRDRAFT_767048?

Purification of recombinant POPTRDRAFT_767048 typically involves affinity chromatography utilizing the N-terminal His-tag . Standard protocols can achieve purity greater than 90% as determined by SDS-PAGE . The purification workflow generally includes:

  • Cell lysis under conditions that solubilize membrane proteins

  • Clarification of lysate by centrifugation

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resins

  • Washing to remove non-specifically bound proteins

  • Elution with imidazole buffer

  • Optional size exclusion chromatography for higher purity

  • Buffer exchange and concentration

For researchers working with membrane proteins like POPTRDRAFT_767048, it is crucial to include appropriate detergents throughout the purification process to maintain protein solubility and native conformation.

What are the optimal storage conditions for POPTRDRAFT_767048?

Purified POPTRDRAFT_767048 is typically supplied as a lyophilized powder . For storage, the following conditions are recommended:

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • For reconstitution, briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended) and aliquot for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles, as these can compromise protein integrity

  • For short-term use, working aliquots can be stored at 4°C for up to one week

The reconstituted protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

How does the structure of POPTRDRAFT_767048 relate to its membrane localization?

As a CASP family protein, POPTRDRAFT_767048 contains four transmembrane domains that are crucial for its localization and function . The transmembrane domains, particularly TM3, contain highly conserved residues essential for proper protein folding and membrane integration . In related CASP proteins, mutation of a conserved Asp residue in TM3 (equivalent to AtCASP1 D134H) prevents proper protein expression, suggesting this residue is critical for structural integrity .

The extracellular loops (EL1 and EL2) also play important roles in protein function. EL2 is well-conserved among CASPLs, while EL1 shows less conservation . Experiments with AtCASP1 have shown that mutations in conserved residues in EL2 affect protein localization to various degrees . For instance, mutations like C168S, F174V, and C175S resulted in prolonged persistence at the lateral plasma membrane, while G158S delayed localization to the CSD . The W164G mutation had the strongest effect, initially excluding the protein from the CSD .

This structure-function relationship suggests that POPTRDRAFT_767048 likely follows similar patterns of membrane localization governed by its transmembrane domains and extracellular loops.

What protein-protein interactions are critical for POPTRDRAFT_767048 function?

While specific interaction partners of POPTRDRAFT_767048 are not directly mentioned in the search results, we can infer potential interactions based on knowledge of related CASP proteins:

  • Peroxidase interactions: CASP proteins mediate the deposition of lignin by interacting with secreted peroxidases . POPTRDRAFT_767048 likely forms similar interactions to facilitate Casparian strip formation.

  • Self-association: CASP proteins form stable membrane domains (CSDs) that act as scaffolds . This implies that POPTRDRAFT_767048 may interact with itself to form oligomeric structures within the membrane.

  • Membrane barrier formation: Related CASPs create a membrane fence that restricts the diffusion of other membrane proteins like NOD26-LIKE INTRINSIC PROTEIN5;1 and BORON TRANSPORTER1 . POPTRDRAFT_767048 may participate in similar barrier-forming interactions.

These interactions collectively contribute to the dual functions of POPTRDRAFT_767048: forming membrane scaffolds and directing cell wall modifications.

How has POPTRDRAFT_767048 evolved in comparison to other CASP family proteins?

CASP and CASP-like (CASPL) proteins have been found in all major divisions of land plants as well as in green algae . Interestingly, homologs outside the plant kingdom have been identified as members of the MARVEL protein family . This evolutionary conservation suggests fundamental roles for these proteins across diverse organisms.

Within plants, the emergence of a CASP-specific signature correlates with the appearance of Casparian strips . Plants lacking Casparian strips do not show this signature in their genomes . This suggests that POPTRDRAFT_767048, as a member of the CASP subfamily, evolved as part of the specialized machinery for Casparian strip formation.

The conservation of specific protein domains also provides insights into evolutionary constraints. Transmembrane domains show high conservation, while extracellular loops, particularly EL1, are more variable . This pattern suggests that membrane integration is under stronger evolutionary constraint than the extracellular regions.

How can POPTRDRAFT_767048 be used to study membrane domain formation?

POPTRDRAFT_767048, as a CASP family protein, offers valuable opportunities for studying membrane domain formation in plants. Researchers can utilize this protein to:

  • Investigate membrane scaffold formation: By expressing fluorescently-tagged POPTRDRAFT_767048 in heterologous systems or plant tissues, researchers can observe the dynamics of membrane domain assembly in real-time.

  • Study membrane barrier properties: Since CASPs form membrane fences that restrict diffusion , POPTRDRAFT_767048 can be used to investigate how these barriers are established and maintained.

  • Examine protein targeting and retention: The mechanisms by which POPTRDRAFT_767048 is initially targeted to the whole plasma membrane and then restricted to specific domains can provide insights into membrane compartmentalization.

  • Explore protein-lipid interactions: The stability of CASP proteins in membrane domains suggests specific protein-lipid interactions that could be studied using POPTRDRAFT_767048 as a model.

These applications leverage the unique properties of POPTRDRAFT_767048 as a membrane domain-forming protein to advance our understanding of fundamental biological processes.

What experimental approaches can reveal the role of POPTRDRAFT_767048 in cell wall modification?

To investigate POPTRDRAFT_767048's role in cell wall modification, researchers can employ several experimental approaches:

  • Co-localization studies: Fluorescently label POPTRDRAFT_767048 and cell wall modification enzymes (e.g., peroxidases) to visualize their spatial relationships during Casparian strip formation.

  • Protein-protein interaction assays: Use techniques such as co-immunoprecipitation, yeast two-hybrid, or bimolecular fluorescence complementation to identify interaction partners involved in cell wall modification.

  • Lignin deposition assays: Measure lignin content and patterning in tissues expressing wild-type or mutant POPTRDRAFT_767048 to assess its impact on cell wall lignification.

  • Domain swapping experiments: Create chimeric proteins with domains from different CASP family members to identify regions responsible for recruiting cell wall modification machinery.

  • Conditional expression systems: Develop inducible expression systems to temporally control POPTRDRAFT_767048 activity and observe subsequent changes in cell wall composition.

These approaches will help elucidate the mechanisms by which POPTRDRAFT_767048 contributes to cell wall modification, particularly in the context of Casparian strip formation.

How can genetic engineering of POPTRDRAFT_767048 improve our understanding of Casparian strip formation?

Genetic engineering of POPTRDRAFT_767048 provides powerful tools for dissecting Casparian strip formation:

  • Site-directed mutagenesis: Creating point mutations in conserved residues can reveal their importance for protein function. For example, mutations similar to those studied in AtCASP1 (e.g., D134H in TM3, or W164G in EL2) could dramatically affect POPTRDRAFT_767048 localization and function .

  • Domain deletion/replacement: Experiments with AtCASP1 showed that deleting extracellular loops affects protein function . Similar approaches with POPTRDRAFT_767048 could identify domain-specific contributions to Casparian strip formation.

  • Heterologous expression: Expressing POPTRDRAFT_767048 in different cell types or organisms can reveal context-dependent aspects of its function and potentially identify missing co-factors required for proper activity.

  • Promoter-reporter fusions: Creating transgenic plants with POPTRDRAFT_767048 promoter driving reporter genes can reveal the spatial and temporal expression patterns, providing insights into when and where the protein functions.

  • CRISPR-Cas9 gene editing: Generating knockout or knockdown mutants in native Populus trichocarpa can reveal phenotypic consequences of POPTRDRAFT_767048 loss and its physiological importance.

These genetic engineering approaches offer complementary insights into the molecular mechanisms of POPTRDRAFT_767048 function in Casparian strip formation.

What statistical approaches are appropriate for analyzing POPTRDRAFT_767048 localization data?

When analyzing POPTRDRAFT_767048 localization data, researchers should consider these statistical approaches:

  • Quantitative image analysis: For fluorescence microscopy data, intensity measurements along membrane cross-sections can be analyzed using:

    • Paired t-tests for comparing intensities at different membrane domains

    • ANOVA for comparing multiple experimental conditions

    • Regression analysis for time-course experiments

  • Co-localization statistics:

    • Pearson's correlation coefficient

    • Manders' overlap coefficient

    • Object-based colocalization analysis

  • Dynamics analysis:

    • Fluorescence recovery after photobleaching (FRAP) data can be analyzed using non-linear regression to determine mobile fractions and half-times of recovery

    • Single-particle tracking can be analyzed using mean square displacement analysis

  • Population distribution analysis:

    • Histogram analysis of fluorescence intensity distributions

    • Kernel density estimation for continuous distribution patterns

    • K-means clustering for identifying distinct localization patterns

When reporting results, researchers should include appropriate measures of central tendency (mean, median) and dispersion (standard deviation, interquartile range), along with sample sizes and p-values.

How can researchers differentiate between specific and non-specific binding in POPTRDRAFT_767048 interaction studies?

Differentiating specific from non-specific interactions is crucial when studying POPTRDRAFT_767048. Researchers should implement these approaches:

  • Control experiments:

    • Use non-relevant proteins with similar properties (size, charge) as negative controls

    • Include competition assays with unlabeled proteins

    • Test interaction with mutated versions of putative binding partners

  • Concentration-dependent analysis:

    • Plot binding curves and analyze saturation kinetics

    • Calculate apparent Kd values for binding

    • Compare affinity constants across different experimental conditions

  • Stringency conditions:

    • Perform binding experiments under increasing salt concentrations

    • Test stability of interactions in different detergents

    • Analyze binding under varying pH conditions

  • Replication and validation:

    • Confirm interactions using multiple independent techniques

    • Test interactions in different expression systems

    • Validate in vitro findings with in vivo experiments

  • Statistical analysis:

    • Set appropriate significance thresholds based on experimental variability

    • Use statistical tests to compare observed interactions with negative controls

    • Apply multiple testing corrections for large-scale interaction studies

These approaches collectively provide confidence in distinguishing genuine POPTRDRAFT_767048 interactions from experimental artifacts.

What bioinformatic tools are most useful for analyzing POPTRDRAFT_767048 and related proteins?

Several bioinformatic tools are particularly valuable for analyzing POPTRDRAFT_767048:

  • Sequence analysis tools:

    • BLAST for identifying homologs across species

    • Multiple sequence alignment tools (MUSCLE, Clustal Omega) for evolutionary analysis

    • HMMER for profile-based sequence searches

  • Protein structure prediction:

    • TMHMM or TOPCONS for transmembrane domain prediction

    • AlphaFold or RoseTTAFold for 3D structure prediction

    • PredictProtein for secondary structure and functional site prediction

  • Evolutionary analysis:

    • MEGA for phylogenetic tree construction

    • PAML for detecting selection signatures

    • ConSurf for identifying conserved functional residues

  • Expression data analysis:

    • GEO or ArrayExpress for expression data mining

    • Gene co-expression network analysis tools

    • Tissue-specific expression databases

  • Functional annotation:

    • Gene Ontology (GO) enrichment analysis

    • Pathway mapping tools (KEGG, Reactome)

    • Protein-protein interaction databases (STRING, BioGRID)

These tools provide complementary insights into POPTRDRAFT_767048 structure, function, evolution, and regulation, facilitating comprehensive characterization of this protein.

How conserved is POPTRDRAFT_767048 across different plant species?

POPTRDRAFT_767048 belongs to the CASP family of proteins, which shows specific evolutionary patterns across plant species. CASPs and CASP-like (CASPL) proteins have been found in all major divisions of land plants as well as in green algae . This broad distribution indicates ancient evolutionary origins and fundamental biological roles.

Analysis of CASP proteins reveals that they contain a specific signature that correlates with the appearance of Casparian strips in the plant kingdom . Plants lacking Casparian strips do not have this signature in their genomes . This suggests that POPTRDRAFT_767048, as a CASP4 protein, likely emerged as part of the specialized cellular machinery required for Casparian strip formation.

At the sequence level, conservation patterns vary across different protein domains:

  • Transmembrane domains show high conservation, particularly TM3 which contains residues essential for protein folding

  • The second extracellular loop (EL2) is well-conserved among CASPLs

  • The first extracellular loop (EL1) shows lower conservation, even within subgroups

  • AtCASPs (from Arabidopsis) have a highly conserved stretch of nine residues in EL1 that is found in all spermatophytes

These conservation patterns provide insights into the structural and functional constraints acting on POPTRDRAFT_767048 throughout evolution.

What can phylogenetic analysis reveal about POPTRDRAFT_767048 evolution?

Phylogenetic analysis of POPTRDRAFT_767048 within the broader context of CASP and CASPL proteins can reveal important evolutionary insights:

  • Evolutionary relationships: CASP proteins form a distinct subfamily within the larger CASPL family . Phylogenetic analysis can place POPTRDRAFT_767048 within this evolutionary framework, identifying its closest relatives and potential functional analogs.

  • Functional specialization: The emergence of the CASP subfamily coincides with the evolution of Casparian strips . Phylogenetic analysis can reveal when POPTRDRAFT_767048-like proteins first appeared and how they diversified across different plant lineages.

  • Selection pressures: Comparing evolutionary rates across different protein domains can identify regions under purifying selection (highly conserved) versus those experiencing diversifying selection.

  • Homology to MARVEL proteins: CASPLs show homology to MARVEL proteins found outside the plant kingdom . Phylogenetic analysis can explore this relationship, potentially revealing the ancestral function of these proteins before they were recruited for Casparian strip formation.

  • Gene duplication events: Identifying paralogous relationships can reveal gene duplication events that contributed to the expansion of the CASP family and subsequent functional diversification.

By integrating these phylogenetic insights with functional data, researchers can develop a comprehensive understanding of how POPTRDRAFT_767048 evolved its specialized role in Casparian strip formation.

How does POPTRDRAFT_767048 compare functionally to homologous proteins in model plant species?

POPTRDRAFT_767048 (PtCASP4) from Populus trichocarpa can be functionally compared to homologous proteins in model plant species, particularly the well-studied Arabidopsis thaliana CASPs:

  • Localization patterns: Arabidopsis CASPs (AtCASPs) are initially targeted to the whole plasma membrane but quickly removed from lateral membranes to localize exclusively at the Casparian strip membrane domain (CSD) . They show extremely low turnover in this domain . POPTRDRAFT_767048 likely shares this distinctive localization pattern, though species-specific differences may exist.

  • Membrane domain formation: AtCASPs create a membrane fence that restricts diffusion of other membrane proteins and lipids . POPTRDRAFT_767048 presumably forms similar diffusion barriers in Populus endodermal cells.

  • Cell wall modification: AtCASPs direct lignin deposition by interacting with secreted peroxidases . This function is likely conserved in POPTRDRAFT_767048, though the specific peroxidases involved may differ between species.

  • Domain functionality: In AtCASP1, mutations in conserved residues affect protein localization to varying degrees . Similar mutations in POPTRDRAFT_767048 would likely produce comparable effects, though subtle differences might reveal species-specific functional adaptations.

  • Expression patterns: While not directly addressed in the search results, CASP proteins generally show tissue-specific expression patterns related to their roles in Casparian strip formation. POPTRDRAFT_767048 expression likely follows similar patterns, though it may be adapted to the specific developmental timing and tissue organization of Populus.

These functional comparisons provide a framework for understanding how POPTRDRAFT_767048 operates in Populus trichocarpa and how its function may be conserved or diverged relative to homologs in other species.

What are common challenges in working with recombinant POPTRDRAFT_767048?

Researchers working with recombinant POPTRDRAFT_767048 may encounter several challenges:

  • Protein solubility issues: As a membrane protein with four transmembrane domains , POPTRDRAFT_767048 may have limited solubility in aqueous buffers. Proper selection of detergents is crucial for maintaining protein solubility throughout purification and experimental procedures.

  • Protein stability concerns: The search results indicate that repeated freeze-thaw cycles should be avoided , suggesting potential stability issues. Researchers should aliquot the protein after reconstitution and be mindful of storage conditions.

  • Expression yield limitations: Membrane proteins often express at lower levels than soluble proteins. Optimization of expression conditions in E. coli may be necessary to achieve sufficient yields.

  • Proper folding: Mutagenesis studies of related CASP proteins indicate that certain residues are critical for proper folding . Researchers should carefully validate the folding state of recombinant POPTRDRAFT_767048 before proceeding with functional studies.

  • Reconstitution challenges: For functional studies, POPTRDRAFT_767048 may need to be reconstituted into membrane mimetics (liposomes, nanodiscs, etc.). This process requires optimization to ensure proper protein orientation and activity.

Addressing these challenges requires careful experimental design and may necessitate technique-specific optimizations.

What controls should be included in experiments involving POPTRDRAFT_767048?

Robust experimental design for POPTRDRAFT_767048 research should include these controls:

  • Negative controls:

    • Empty vector controls for expression studies

    • Non-relevant proteins with similar properties for interaction studies

    • Boiled/denatured POPTRDRAFT_767048 for activity assays

    • Tissues or cells lacking POPTRDRAFT_767048 expression

  • Positive controls:

    • Well-characterized CASP proteins from model organisms

    • Known interaction partners of related CASP proteins

    • Tissues with confirmed Casparian strip formation

  • Technical controls:

    • Buffer-only samples to account for background signals

    • Loading controls for western blots

    • Internal standards for quantitative measurements

    • Multiple independently prepared protein batches to assess reproducibility

  • Validation controls:

    • Alternative methods to confirm key findings

    • Rescue experiments in knockout/knockdown studies

    • Concentration gradients to establish dose-dependency

    • Time-course experiments to capture dynamics

  • Specificity controls:

    • Mutated versions of POPTRDRAFT_767048 (based on known functional residues in related CASPs)

    • Competition assays with unlabeled proteins

    • Heterologous expression in different cell types

These controls collectively enhance the reliability and interpretability of experiments involving POPTRDRAFT_767048.

How can researchers optimize storage and handling of POPTRDRAFT_767048 to maintain activity?

To maintain POPTRDRAFT_767048 activity, researchers should follow these optimized storage and handling protocols:

  • Initial storage:

    • Store the lyophilized protein at -20°C/-80°C upon receipt

    • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitution:

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended)

    • Use Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Aliquoting and long-term storage:

    • Divide the reconstituted protein into small aliquots to avoid repeated freeze-thaw cycles

    • Store aliquots at -20°C/-80°C for long-term storage

    • Label tubes with protein information, concentration, date, and freezing iteration

  • Short-term usage:

    • Working aliquots can be stored at 4°C for up to one week

    • Return to -20°C promptly after use

    • Track the number of freeze-thaw cycles for each aliquot

  • Handling precautions:

    • Maintain samples on ice when working at the bench

    • Use low-protein-binding tubes and pipette tips

    • Consider adding protease inhibitors for sensitive applications

    • Filter solutions if precipitates form

Following these guidelines will help maintain POPTRDRAFT_767048 stability and activity, ensuring reliable experimental results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.