Recombinant Populus trichocarpa NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Populus trichocarpa NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic, is a protein component of the NAD(P)H dehydrogenase (NDH) complex found in the chloroplasts of Populus trichocarpa, also known as the western balsam poplar . The NDH complex is crucial for various photosynthetic processes, including cyclic electron flow and stress responses in plants .

Basic Information

AttributeDescription
NameRecombinant Populus trichocarpa NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic
Source OrganismPopulus trichocarpa (Western balsam poplar)
SubunitSubunit 3 (ndhC)
FunctionPart of the NAD(P)H dehydrogenase (NDH) complex in chloroplasts
Tag InfoThe tag type is determined during the production process

Function and Role

The NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic, is a component of the NDH complex, which plays a vital role in the following:

  • Electron Transfer: It participates in the transfer of electrons from NAD(P)H to quinones within the photosynthetic electron transport chain .

  • Cyclic Electron Flow: The NDH complex is involved in cyclic electron flow around photosystem I (PSI), which helps in ATP production and balancing the ATP/NADPH ratio in chloroplasts .

  • Stress Response: It assists plants in coping with environmental stresses such as high light intensity and drought .

Recombinant Production

Recombinant proteins like Populus alba NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic, are produced using engineered expression systems, such as E. coli . The protein is expressed with an N-terminal His tag to facilitate purification .

Example of Recombinant Populus alba NAD(P)H-quinone Oxidoreductase Subunit 3, Chloroplastic Protein :

Cat.No. :RFL12333PF
Product Overview :Recombinant Full Length Populus alba NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic(ndhC) Protein (Q14FF2) (1-120aa), fused to N-terminal His tag, was expressed in E. coli.

Related Research and Applications

  1. ELISA Development: Recombinant Populus trichocarpa NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic can be used in Enzyme-Linked Immunosorbent Assays (ELISA) for detecting and quantifying the protein in plant samples .

  2. NDH Complex Studies: It can serve as a tool to study the structure, function, and regulation of the NDH complex in plants .

  3. Plant Stress Physiology: Researchers can utilize it to investigate the role of the NDH complex in plant responses to various environmental stresses .

Other Subunits

Besides subunit 3 (ndhC), other subunits of the NDH complex in Populus trichocarpa include:

  • Subunit 1, chloroplastic

  • Subunit H, chloroplastic

  • Subunit 4L, chloroplastic

  • Subunit S, chloroplastic

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ndhC; Poptr_cp027; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWAFLIISSVIPILAFLISGLLSPIRKGPEKLSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILIVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H to plastoquinone via FMN and iron-sulfur (Fe-S) centers within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, conserving redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of the NAD(P)H-quinone oxidoreductase complex in Populus trichocarpa?

The NAD(P)H-quinone oxidoreductase (NDH) complex in Populus trichocarpa functions as a ferredoxin:plastoquinone oxidoreductase, mediating cyclic electron transport around photosystem I (PSI) and participating in chlororespiration.

Structurally, the complex has an approximate molecular mass of 550 kDa and consists of multiple subunits organized into subcomplexes . The purified NDH complex consists of at least 16 subunits, including NdhA, NdhI, NdhJ, NdhK, and NdhH, which have been identified through N-terminal sequencing and immunoblotting . Unlike the respiratory complex I, the chloroplast NDH complex lacks the traditional N-module for NADH binding and instead accepts electrons from reduced ferredoxin .

The NDH complex in Populus trichocarpa forms a supercomplex with photosystem I (PSI) via linker proteins, including Lhca5 and Lhca6. This NDH-PSI supercomplex represents one of the largest photosynthetic electron transport chain complexes . The interaction between NDH and PSI enhances cyclic electron flow, which is particularly important under stress conditions.

Methodology for isolation and characterization:

  • Selective solubilization of thylakoid membranes with detergents like dodecyl maltoside

  • Sequential purification through anion-exchange chromatography and size-exclusion chromatography

  • Identification of subunits through N-terminal sequencing and immunoblotting

  • Analysis of enzymatic activity using electron acceptors such as ferricyanide or quinones

How is the expression of NDH subunit 3 regulated in Populus trichocarpa under different environmental conditions?

The expression of NDH subunits in Populus trichocarpa is dynamically regulated in response to various environmental stressors, particularly salt and heavy metal stress.

Research has shown that several NDH-related genes are upregulated under salt stress conditions. For example, in a study of stress-associated proteins (SAPs) in P. trichocarpa, PtSAP13 was significantly upregulated during salt treatment, with expression increasing ~8-fold at 1 hour and reaching maximal levels (~12-fold) at 6 hours post-treatment . This coincided with increased activities of antioxidant enzymes, including peroxidase (POD), superoxide dismutase (SOD), and catalase (CAT), suggesting a coordinated response to oxidative stress .

For heavy metal stress, particularly cadmium (Cd), the thiol reductase PtOSH1 from P. trichocarpa has been shown to enhance plant tolerance by regulating the reactive oxygen species (ROS)-scavenging system . Overexpression of PtOSH1 in Arabidopsis increased the activities of SOD, POD, and CAT, improving plant resistance to Cd stress .

Methodological approaches for studying regulation:

  • Quantitative RT-PCR to measure expression levels under different conditions

  • Proteomic analyses to detect changes in protein abundance

  • Transgenic approaches to study the effects of overexpression or knockdown

  • Measurement of enzyme activities to correlate with expression changes

What experimental methods are typically used to express and purify recombinant Populus trichocarpa NDH subunit 3?

Expression and purification of recombinant NDH subunit 3 from Populus trichocarpa typically involves:

  • Cloning strategy:

    • Isolation of cDNAs for NDH genes from Populus trichocarpa

    • Design of expression vectors incorporating appropriate tags for purification

    • Co-expression with other NDH subunits when studying interactions

  • Expression systems:

    • Prokaryotic systems: E. coli for initial characterization

    • Yeast (Saccharomyces cerevisiae) for co-expression with other plant proteins

    • Plant-based expression systems for more authentic post-translational modifications

  • Purification protocol:

    • Selective membrane solubilization using mild detergents

    • Affinity chromatography using engineered tags

    • Size-exclusion chromatography for isolating intact complexes

    • Anion-exchange chromatography for further purification

  • Functional verification:

    • NADPH-dependent cytochrome c reduction assays

    • Ferricyanide reduction assays

    • Quinone (menadione and duroquinone) reduction assays

For example, researchers have successfully expressed hybrid poplar (Populus trichocarpa x Populus deltoides) genes in yeast, demonstrating that co-expression of CPR1 or CPR2 with C4H enhanced activities approximately 10-fold relative to C4H-only controls . This co-expression system enabled functional characterization through measurement of NADPH-dependent cytochrome c reduction .

How does the structure and function of the NDH complex in Populus trichocarpa compare to other species, and what evolutionary insights can be drawn?

The NDH complex has evolved from respiratory complex I but has acquired unique characteristics in different plant lineages. Comparative analysis reveals both conserved features and lineage-specific adaptations.

Structural comparisons:

The chloroplast NDH complex in Populus trichocarpa, like in other angiosperms, forms a supercomplex with photosystem I (PSI) via linker proteins, particularly Lhca5 and Lhca6 . The acquisition of Lhca6 represents a relatively recent evolutionary event, occurring in a common ancestor of angiosperms . This contrasts with non-angiosperm plants that lack this specific supercomplex formation.

Evolutionary analysis of NDH subunits has revealed that:

  • PnsB2 was newly acquired via tandem gene duplication of NDF5 at some point in angiosperm evolution

  • PnsB3, another Lhca6 contact subunit, evolved from a protein unrelated to NDH

  • The electron input module has undergone significant modification from the ancestral complex I

Functional comparisons:

While the core function of mediating cyclic electron flow around PSI is conserved across species, the regulatory mechanisms and stress responses show variation. For instance, in Arabidopsis, the SH3-like domain protein NdhS/CRR31 is crucial for high-affinity binding of ferredoxin, with specific residues like Arg-193 playing critical roles in electrostatic interaction . Similar mechanisms likely exist in Populus but may have species-specific adaptations.

Methodological approaches for evolutionary studies:

  • Comparative genomics to identify orthologs across species

  • Phylogenetic analysis to trace gene duplication and divergence events

  • Structure-function studies of conserved domains

  • Heterologous expression to test functional conservation

How do mutations in specific functional domains of NDH subunit 3 affect electron transport and stress response in Populus trichocarpa?

Mutagenesis studies of NDH subunits have provided critical insights into structure-function relationships and the role of specific residues in electron transport and stress responses.

Domain-specific effects:

The NDH complex contains several functional domains critical for electron transport, including regions involved in ferredoxin binding, quinone reduction, and proton translocation. Mutations in these domains can have distinct effects:

  • Ferredoxin binding domain mutations:
    Studies in Arabidopsis have shown that mutation of positively charged residues in the SH3-like domain of NdhS significantly decreases the efficiency of ferredoxin-dependent plastoquinone reduction . Specifically, the replacement of arginine 193 with negatively charged residues (aspartate or glutamate) or hydrophobic alanine substantially reduces NDH activity both in vitro and in vivo .

  • Proton channel mutations:
    Mutations in the proton channel region, such as K240M and E152Q substitutions in NdhF, do not interfere with NDH assembly with PSI but can affect the accumulation of free NDH complex . In contrast, deletion of the transverse helix of NdhF (W645* mutation) leads to complete loss of the PSI-NDH supercomplex .

  • Electron transport chain mutations:
    Mutations affecting the electron transport chain of NDH can alter post-illumination fluorescence, indicating impaired NDH activity. While these mutations may not affect protein complex content, they can significantly impact proton translocation into the lumen .

Methodological approaches for mutation studies:

  • Site-directed mutagenesis to target specific residues

  • In planta mutagenesis for physiological relevance

  • Measurement of NDH activity through chlorophyll fluorescence techniques

  • Analysis of protein-protein interactions through co-immunoprecipitation

  • Blue native electrophoresis to assess complex formation

  • Spectroscopic methods to directly measure electron transfer rates

What are the optimal experimental conditions for assessing NDH-mediated cyclic electron flow in Populus trichocarpa chloroplasts?

Assessment of NDH-mediated cyclic electron flow in Populus trichocarpa requires careful experimental design and consideration of multiple parameters:

Technical approaches:

  • Chlorophyll fluorescence measurements:

    • Post-illumination fluorescence rise (PIFR) after turning off actinic light provides a direct measure of NDH activity in vivo

    • The transient increase in chlorophyll fluorescence (F₀' rise) reflects non-photochemical reduction of plastoquinone by NDH in the dark

    • Comparison with NDH-deficient mutants helps quantify contribution of NDH to total cyclic electron flow

  • Electron transport rate (ETR) measurements:

    • Light intensity dependence of ETR provides insights into NDH contribution under different conditions

    • Analysis of 1-qL parameter (reflecting plastoquinone redox state) complements ETR measurements

  • Proton motive force assessment:

    • Electrochromic shift (ECS) measurements to estimate total proton motive force (pmf)

    • Analysis of trans-thylakoid proton conductivity (gH+) through ECS decay kinetics

    • Estimation of ΔpH-dependent component of non-photochemical quenching (qE)

Experimental conditions to consider:

ParameterOptimal RangeNotes
Light intensity95-700 μmol photons m⁻² s⁻¹NDH contribution more pronounced at lower intensities
Temperature20-25°CHigher temperatures may accelerate reactions
CO₂ concentrationAmbient to low (50-100 ppm)Low CO₂ enhances cyclic electron flow
Measurement timingDark adaptation: 10-15 min; Actinic light: 5-10 minAllows reaching steady state
Plant age4-6 weeksFully developed but not senescent leaves

Control experiments:

  • Comparison with known NDH-deficient mutants (e.g., ndho mutant)

  • Analysis of PGR5-dependent pathway using pgr5 mutants

  • Inhibitor studies with antimycin A (inhibits PGR5 pathway but not NDH)

  • Overexpression of NTRC as a positive control for enhanced NDH activity

What are the current challenges and future directions in studying NDH complex assembly and regulation in Populus species?

Current challenges:

  • Complex assembly mechanism:
    The assembly of the NDH complex involves coordination between chloroplast-encoded and nuclear-encoded subunits, requiring temporal and spatial regulation. Understanding this process in Populus species remains challenging, particularly regarding the role of assembly factors and chaperones.

  • Structural determination:
    While the general structure of the NDH complex is known, high-resolution structures of the Populus-specific complex are lacking, limiting our understanding of species-specific features and interaction surfaces.

  • Regulatory networks:
    The complex regulatory networks controlling NDH expression, assembly, and activity under different environmental conditions remain poorly characterized in Populus species, particularly regarding cross-talk with other stress response pathways.

  • Tissue-specific functions:
    The function of NDH may vary across different tissues and developmental stages in Populus trees, but most studies focus on mature leaf tissue, leaving other contexts understudied.

Future directions:

  • Application of CRISPR-Cas9 technology:
    CRISPR-Cas9 has been successfully applied in Populus trichocarpa , offering opportunities for precise genetic manipulation of NDH subunits and regulatory factors. Future studies could employ this technology to:

    • Create knockout or knockdown lines for specific NDH subunits

    • Introduce point mutations to study structure-function relationships

    • Generate reporter lines for monitoring expression and localization

  • Integrative omics approaches:
    Combining proteomic, transcriptomic, and metabolomic approaches can provide a comprehensive understanding of NDH regulation. For example, proteomics studies in Populus nigra have already identified differential expression of several enzymes, including enolase and peroxidase, in response to mechanical stress . Similar approaches could be applied to study NDH regulation under various conditions.

  • Systems biology models:
    Development of mathematical models integrating electron transport, proton translocation, and regulatory networks could help predict NDH behavior under different environmental scenarios and guide experimental design.

  • Comparative studies across Populus species:
    Studies comparing NDH structure, function, and regulation across different Populus species and hybrids could provide insights into adaptation to different ecological niches and guide breeding programs for stress tolerance.

How can oxidoreductase enzymes from Populus trichocarpa be optimized for applications in non-aqueous biocatalysis systems?

Current limitations:

  • Solvent compatibility:
    Native oxidoreductases almost universally exhibit low activities and stabilities in non-aqueous systems, as they have naturally evolved to catalyze reactions in aqueous environments .

  • Cofactor regeneration:
    NAD(P)H cofactor regeneration is challenging in organic media due to solubility issues and altered enzyme kinetics.

  • Substrate specificity:
    The asymmetric reduction of hydrophobic and bulky substrates remains challenging due to low solubility and steric hindrance effects .

Optimization strategies:

  • Structural analysis and engineering:
    Analysis of amino acid interaction networks can explain organic solvent tolerance mechanisms and guide protein engineering efforts . Specific approaches include:

    • Conservation and co-evolution analysis of extreme oxidoreductases

    • Identification of critical residues involved in organic solvent tolerance

    • Introduction of stabilizing mutations through site-directed mutagenesis

  • Multifaceted screening approaches:
    Combining genome mining with bioinformatics provides new insights for discovering and identifying novel extreme oxidoreductases . Methods include:

    • Mining extremophile genomes for oxidoreductase candidates

    • Screening for organic solvent tolerance

    • Assessing activity with industrially relevant substrates

  • Optimization of reaction conditions:
    The following parameters should be optimized for each enzyme-solvent-substrate combination:

    • Water activity

    • Solvent polarity

    • Temperature

    • pH (in the microaqueous environment)

    • Immobilization strategy

Application areas:

Application AreaAdvantages of Populus OxidoreductasesChallenges
Pharmaceutical intermediatesEnantioselective reduction capabilitiesMaintaining stereoselectivity in organic media
Flavors and fragrancesMild reaction conditionsVolatile substrate handling
BioremediationAbility to transform hydrophobic pollutantsScale-up and enzyme stability
BiosensorsSpecificity for target analytesLong-term operational stability

What methodological approaches are most effective for studying the redox regulation of NDH complex in Populus trichocarpa?

The NDH complex in Populus trichocarpa, like in other plants, is subject to sophisticated redox regulation that fine-tunes its activity in response to changing environmental conditions. Studying this regulation requires a combination of biochemical, genetic, and biophysical approaches:

Biochemical approaches:

  • Thiol-disulfide exchange analysis:

    • Identification of redox-active cysteines using mass spectrometry

    • Analysis of thiol status using thiol-specific probes (e.g., monobromobimane)

    • In vitro reconstitution of thiol-disulfide exchange reactions

  • Redox titrations:

    • Determination of midpoint potentials of redox-active sites

    • Assessment of redox-dependent conformational changes

    • Correlation of redox state with activity measurements

Studies have shown that thiol reductases like PtOSH1 from Populus trichocarpa can catalyze the reduction of disulfide bonds and behave as sulfhydryl reductases under acidic conditions . Such enzymes may play roles in the redox regulation of the NDH complex and other photosynthetic components.

Genetic approaches:

  • Mutant analysis:

    • Characterization of mutants lacking specific redox regulators

    • Analysis of site-directed mutants with altered redox-active sites

    • Generation of transgenic lines with modified redox regulation

  • Expression analysis:

    • Monitoring expression of redox regulators under different conditions

    • Correlation of expression patterns with NDH activity

    • Identification of transcription factors controlling redox regulators

Research has demonstrated that NTRC (NADPH-thioredoxin reductase C) activates NDH-dependent cyclic electron flow . Overexpression of NTRC resulted in significantly larger post-illumination fluorescence rise (PIFR) after pre-illumination with low-intensity white light, suggesting increased cyclic electron flow activity .

Biophysical approaches:

  • Spectroscopic methods:

    • EPR spectroscopy to monitor redox states of iron-sulfur clusters

    • Time-resolved fluorescence to measure electron transfer kinetics

    • Resonance Raman spectroscopy for studying structural changes

  • Structural studies:

    • Cryo-electron microscopy to visualize redox-dependent structural changes

    • X-ray crystallography of individual subunits under different redox conditions

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

Integrated systems biology approach:

To fully understand the redox regulation of the NDH complex, integration of multiple data types is essential:

  • Correlation of transcriptomic, proteomic, and metabolomic data

  • Mapping of redox-dependent protein-protein interactions

  • Development of mathematical models describing redox regulation

  • Validation of models through targeted experiments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.