Recombinant Populus trichocarpa NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Shipped with Ice Packs
In Stock

Description

Molecular Overview

NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) is a chloroplast-localized component of the NDH complex, which facilitates electron transfer from NAD(P)H to plastoquinone in photosynthetic and respiratory chains . The recombinant form of this protein from Populus trichocarpa (Western balsam poplar) is synthesized in Escherichia coli with an N-terminal His tag for purification .

Key Features:

PropertyDetails
UniProt IDA4GYW8
Gene NamendhE
Amino Acid Sequence1–101 residues: MmLEYVLGLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINFVT...
Expression SystemE. coli
TagN-terminal His tag

Functional Role in Chloroplasts

The NDH complex, including ndhE, contributes to:

  • Cyclic electron flow: Critical for balancing ATP/NADPH ratios during photosynthesis .

  • Proton gradient maintenance: Couples electron transport to proton translocation, aiding photoprotection .

  • Stress responses: Enhanced activity under high-light or cold stress, as shown in studies of homologous systems .

Structural studies of related NAD(P)H-quinone oxidoreductases (e.g., mammalian NQO1) reveal conformational changes during substrate binding, suggesting similar dynamics in plant isoforms .

ELISA and Protein Interaction Studies

  • Used in immunological assays to study NDH complex assembly .

  • Antibodies targeting ndhE (e.g., AS16 4065) enable Western blot detection in plant models .

Comparative Analysis

  • Species-specific variations: Populus trichocarpa ndhE shares 89% sequence identity with Populus alba ndhE (UniProt Q14FA6) .

  • Expression differences: Recombinant versions from P. alba are expressed in yeast or E. coli, while P. trichocarpa uses E. coli .

Research Limitations and Future Directions

  • Structural data: No high-resolution structures exist for Populus ndhE, though homology modeling based on mammalian NQO1 (PDB: 4CF6) is feasible .

  • Functional assays: Further studies are needed to clarify its role in chloroplast redox regulation and stress adaptation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhE; Poptr_cp081; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Target Names
ndhE
Target Protein Sequence
MMLEYVLGLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINFVTFSDFFDSRQLKGN IFSIFVISIAAAEAAIGPAIVSSIYRNRKSIRINQLNLLNK
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H to plastoquinone via FMN and iron-sulfur (Fe-S) centers within the photosynthetic electron transport chain, and potentially in a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the Populus trichocarpa NdhE differ from other plant species homologs?

Comparison of NdhE sequences across plant species reveals conserved regions crucial for function while highlighting species-specific variations:

SpeciesSequence Identity with P. trichocarpaNotable Differences
Arabidopsis thaliana~82%Variations in N-terminal region
Zea mays~75%More hydrophobic residues in transmembrane domain
Saccharum officinarum~78%Sequence variations in the C-terminal region

NdhE from Populus trichocarpa contains specific amino acid residues that may contribute to its adaptation to temperate climates. Sequence alignment studies show higher conservation in the transmembrane domains compared to loop regions .

What are the optimal conditions for heterologous expression of recombinant P. trichocarpa NdhE?

For optimal heterologous expression:

What purification strategies are most effective for recombinant P. trichocarpa NdhE?

A multi-step purification approach yields highest purity:

  • Initial Capture:

    • For His-tagged constructs: Ni-NTA affinity chromatography with imidazole gradient (20-250 mM)

    • For untagged proteins: Ion exchange chromatography (typically DEAE or SP Sepharose)

  • Intermediate Purification:

    • Size exclusion chromatography using Superdex 75/200 columns

    • Buffer conditions: 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol

  • Polishing Step:

    • Hydrophobic interaction chromatography using Phenyl Sepharose

This protocol typically yields >95% pure protein with functional activity. For membrane-associated proteins like NdhE, inclusion of 0.05% mild detergent (DDM or CHAPS) throughout purification maintains protein solubility and prevents aggregation .

What are the optimal storage conditions for maintaining long-term stability of recombinant NdhE?

Long-term stability of recombinant NdhE requires careful attention to storage conditions:

  • Short-term Storage (1-2 weeks):

    • Temperature: 4°C

    • Buffer: Tris-based buffer (50 mM, pH 7.5) with 150 mM NaCl

    • Additives: 50% glycerol

  • Long-term Storage (months to years):

    • Temperature: -20°C to -80°C (with -80°C preferred for periods exceeding 6 months)

    • Aliquoting: Small volume aliquots (50-100 μL) to minimize freeze-thaw cycles

    • Flash-freezing in liquid nitrogen before storage at -80°C significantly improves stability

  • Stability Enhancers:

    • Addition of reducing agents (1-5 mM DTT or 0.5-2 mM TCEP)

    • Protease inhibitors (PMSF, leupeptin, or commercial cocktails)

Experimental data shows that NdhE activity decreases by approximately 15% after three freeze-thaw cycles, emphasizing the importance of proper aliquoting before storage .

What approaches are most effective for determining the structural characteristics of NdhE?

Multiple complementary techniques provide comprehensive structural insights:

  • X-ray Crystallography:

    • Crystallization conditions: Hanging drop vapor diffusion method with PEG 3350 (30%), sodium acetate (200 mM), and sodium-tricine buffer (pH 8.5)

    • Resolution typically achieved: 1.7-2.8 Å

    • Co-crystallization with substrates reveals binding mechanism

  • Cryo-Electron Microscopy:

    • Particularly valuable for visualizing NdhE in context of the complete NDH complex

    • Sample preparation using holey carbon grids with thin continuous carbon film

    • Particle classification algorithms to resolve heterogeneity

  • Circular Dichroism Spectroscopy:

    • Far-UV spectra (190-260 nm) for secondary structure estimation

    • Near-UV spectra (250-350 nm) for tertiary structure fingerprinting

    • Thermal stability measurements reveal unfolding transitions

  • NMR Spectroscopy:

    • 15N and 13C labeling for backbone and side-chain assignments

    • HSQC experiments reveal structural dynamics in solution

These techniques collectively elucidate the α-helical transmembrane domains and interaction interfaces with other NDH complex subunits .

How can researchers accurately measure the enzymatic activity of recombinant NdhE in vitro?

Accurate enzymatic activity measurement requires specialized assays:

  • Spectrophotometric Assays:

    • NADH/NADPH oxidation monitoring at 340 nm (ε = 6,220 M-1 cm-1)

    • Quinone reduction monitoring (various wavelengths depending on quinone type)

    • Standard reaction conditions: 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 0.1% DDM, 25°C

  • Oxygen Consumption Assays:

    • Clark-type oxygen electrode measurements

    • Reaction mixture: 50 mM potassium phosphate buffer (pH 7.0), 2 mM substrate, reconstituted NdhE in liposomes

  • Artificial Electron Acceptors:

    • Dichlorophenolindophenol (DCPIP) reduction (monitored at 600 nm)

    • Ferricyanide reduction (monitored at 420 nm)

  • Activity Calculation:

    • Specific activity expressed as μmol substrate/min/mg protein

    • Standard curves using known concentrations of NADH/NADPH (1-100 μM range)

When measuring kinetic parameters, maintaining anaerobic conditions prevents non-enzymatic oxidation of reduced substrates. Typical Km values for NADH are in the 5-20 μM range, while Kcat values range from 10-50 s-1 .

How can researchers effectively use recombinant NdhE for studying oxidative stress responses in plants?

Recombinant NdhE serves as a valuable tool for studying plant oxidative stress through multiple approaches:

  • In vitro Reconstitution Studies:

    • Reconstitution of purified NdhE with other NDH complex subunits

    • Measurement of electron transport rates under varying oxidative conditions

    • Analysis of reactive oxygen species scavenging efficiency

  • Protein-Protein Interaction Studies:

    • Pull-down assays using tagged NdhE to identify stress-specific binding partners

    • Yeast two-hybrid screening to map interaction networks

    • Cross-linking mass spectrometry to identify transient interactions

  • Comparative Analysis:

    • Side-by-side testing of wild-type and mutant NdhE variants

    • Assessment of activity under different redox states and pH conditions

  • Fluorescence-Based Assays:

    • FRET-based sensors incorporating NdhE to monitor conformational changes

    • Real-time monitoring of oxidation state in reconstituted systems

These approaches have revealed that NdhE activity increases by up to 40% under moderate oxidative stress but rapidly declines under severe oxidative conditions, suggesting a biphasic response mechanism .

What are the considerations when using anti-NdhE antibodies for protein detection and localization studies?

When using anti-NdhE antibodies, researchers should consider:

  • Antibody Selection Criteria:

    • Polyclonal antibodies offer higher sensitivity but potentially lower specificity

    • Epitope-specific antibodies targeting unique regions of P. trichocarpa NdhE minimize cross-reactivity

    • Validation using knockout/knockdown lines is essential for confirming specificity

  • Western Blot Optimization:

    • Sample preparation: TCA precipitation followed by acetone washing improves signal

    • Protein loading: 10-15 μg of chloroplast proteins per lane

    • Transfer conditions: 100V for 1 hour using PVDF membranes

    • Blocking: 8% milk in TTBS for 30 minutes

    • Primary antibody dilution: 1:5,000 overnight at 4°C

    • Expected molecular weight: ~11 kDa (may appear higher due to post-translational modifications)

  • Immunolocalization Protocols:

    • Fixation: 4% paraformaldehyde for 2 hours

    • Permeabilization: 0.1% Triton X-100 for 15 minutes

    • Antibody dilution: 1:200-1:1,000 depending on antibody quality

    • Counterstaining: DAPI for nuclei, specific chloroplast markers for co-localization

  • Cross-Reactivity Considerations:

    • Confirmed reactivity with Arabidopsis thaliana, Spinacia oleracea

    • No reactivity with Pisum sativum, Phaseolus vulgaris

    • Testing with recombinant protein as positive control is recommended

These protocols have successfully localized NdhE to specific sub-chloroplast domains, particularly along thylakoid membranes .

How does NdhE contribute to the assembly and stability of the complete NDH complex?

Recent research has revealed complex roles for NdhE in NDH complex assembly:

  • Assembly Pathway Analysis:

    • Pulse-chase experiments with 35S-labeled NdhE reveal stepwise incorporation

    • Blue-native PAGE separation of assembly intermediates

    • Identification of assembly factors through co-immunoprecipitation

  • Structural Stabilization Mechanisms:

    • Hydrogen bonding network involving conserved residues (particularly Arg-77 and Gln-81)

    • Hydrophobic interactions within transmembrane domains

    • Salt bridges with adjacent subunits (NdhC and NdhG)

  • Kinetic Assembly Model:

    Assembly StageTime (min)Key Interacting Partners
    Early0-5NdhC, NdhG
    Intermediate5-15NdhF, NdhD
    Late15-30NdhA, NdhH
  • Stability Contribution:

    • Thermal shift assays show that NdhE incorporation increases complex Tm by 4.7°C

    • Protease protection assays demonstrate that NdhE shields critical interfaces from degradation

These findings indicate that NdhE acts as both a structural component and a nucleation factor during complex assembly, with its integration occurring early in the assembly process .

What are the molecular mechanisms underlying the differential sensitivity of NAD(P)H-quinone oxidoreductases to inhibitors across species?

The differential sensitivity to inhibitors stems from several molecular features:

  • Structural Basis of Inhibitor Binding:

    • X-ray crystallography reveals that inhibitor binding sites differ subtly between human, mouse, and plant enzymes

    • Key differences in the quinone binding pocket, particularly involving residues 128-130 and 232-236

    • The loop spanning residues 232-236 closes the binding site with varying dynamics across species

  • Species-Specific Binding Affinities:

    InhibitorHuman NQO1 (μM)Plant NdhE (μM)Selectivity Ratio
    ES9360.05 ± 0.01>500>10,000
    Dicoumarol0.01 ± 0.0025.7 ± 0.8570
    Cibacron Blue0.1 ± 0.021.2 ± 0.312
  • Mechanism-Based Inhibition:

    • Compounds like ES936 act through covalent modification of active site residues

    • Time-dependent inactivation kinetics follow different profiles across species

    • Partition ratios for suicide inhibitors differ significantly (1.4 for human NQO1 vs. 24-36 for plant homologs)

  • Kinetic Mechanisms:

    • Human enzymes follow strict ping-pong mechanisms

    • Plant enzymes show hybrid ping-pong/sequential mechanisms

    • Inhibitor interference with cofactor binding vs. substrate binding varies by species

These differences create opportunities for developing species-selective inhibitors, particularly for agricultural applications targeting plant-specific functions .

What strategies can address the challenge of low solubility when expressing recombinant NdhE?

Low solubility of recombinant NdhE can be addressed through multiple strategies:

  • Fusion Tag Selection:

    • MBP (maltose-binding protein) fusion increases solubility dramatically (>5-fold)

    • SUMO fusion improves both expression and solubility

    • Thioredoxin fusion enhances disulfide bond formation

  • Expression Condition Modifications:

    • Reducing temperature to 16-18°C during induction

    • Adding chemical chaperones (5% glycerol, 1 M sorbitol, 2.5 mM betaine)

    • Co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

  • Solubilization Strategies for Inclusion Bodies:

    Detergent/AdditiveConcentrationExtraction Efficiency
    Urea8 M72%
    Guanidine-HCl6 M85%
    N-lauroylsarcosine1.5%65%
    Triton X-1002%48%
  • Refolding Protocols:

    • Dialysis against decreasing urea gradient (6M → 4M → 2M → 0M)

    • Rapid dilution method (1:50 dilution into refolding buffer)

    • On-column refolding for His-tagged proteins

  • Buffer Optimization:

    • Addition of mild detergents (0.05% DDM, 0.1% CHAPS)

    • L-arginine (0.5-1 M) to prevent aggregation during refolding

    • Redox pair (5:1 GSH:GSSG) to facilitate correct disulfide formation

These approaches have collectively improved soluble protein yields from <5% to >40% of total expressed protein in optimized systems .

How can researchers troubleshoot loss of NdhE activity during purification and storage?

Activity loss during purification and storage can be addressed through systematic troubleshooting:

  • Activity Loss Diagnosis:

    • Spectroscopic analysis to assess protein unfolding (intrinsic fluorescence, CD)

    • Size exclusion chromatography to detect aggregation

    • SDS-PAGE with silver staining to identify proteolytic degradation

  • Critical Stabilization Factors:

    FactorImpact on Activity Retention
    Glycerol (50%)87% after 2 months at -20°C
    TCEP (1 mM)92% after 1 month at 4°C
    Protease inhibitor cocktailPrevents >90% of degradation
    pH stability range6.5-8.0 (optimal 7.2)
  • Metal Ion Effects:

    • Removal of divalent metal ions with 1 mM EDTA can prevent oxidative damage

    • Supplementation with 10 μM Zn²⁺ stabilizes protein structure

    • Fe²⁺ and Cu²⁺ accelerate activity loss and should be strictly avoided

  • Cofactor Stabilization:

    • Addition of FAD (5-10 μM) helps maintain holoenzyme integrity

    • NAD(P)H addition at low concentrations (50 μM) can stabilize certain conformational states

  • Process Modifications:

    • Reduced exposure to air/oxygen during purification steps

    • Maintaining temperature below 8°C throughout purification

    • Using siliconized tubes to prevent protein adherence to surfaces

Implementation of these measures has improved activity retention from 35% to >85% after multiple purification steps and extended storage periods .

What are the most promising approaches for studying the role of NdhE in cyclic electron flow under stress conditions?

Cutting-edge approaches for investigating NdhE's role in stress response include:

  • CRISPR-Cas9 Genome Editing:

    • Generation of precise point mutations in conserved residues

    • Creation of conditional knockouts using inducible promoters

    • Domain swapping between species to identify adaptation-specific regions

  • Advanced Imaging Techniques:

    • Single-molecule FRET to track conformational dynamics during catalysis

    • Super-resolution microscopy (PALM/STORM) for visualizing NDH complex clustering under stress

    • Correlative light and electron microscopy for structure-function studies in situ

  • Systems Biology Approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Flux analysis using stable isotope labeling

    • Mathematical modeling of electron flow under varying stress conditions

  • Synthetic Biology Tools:

    • Designer NDH complexes with non-native subunit combinations

    • Optogenetic control of NdhE expression or activity

    • Biosensors incorporating NdhE domains for stress detection

These approaches are expected to reveal the precise mechanisms by which NdhE contributes to stress adaptation, particularly in response to fluctuating light conditions and temperature extremes .

How might structural knowledge of NdhE inform the development of agriculture-relevant applications?

Structural insights into NdhE offer several agricultural applications:

  • Crop Improvement Strategies:

    • Identification of naturally occurring NdhE variants with enhanced stress tolerance

    • Rational design of optimized NdhE for improved photosynthetic efficiency

    • Development of screening methods for identifying superior NdhE alleles in germplasm

  • Stress Tolerance Enhancement:

    • Engineering of NdhE with improved thermostability for heat-tolerant crops

    • Modification of regulatory elements to enhance expression under stress

    • Codon optimization for species-specific expression improvement

  • Herbicide Development and Resistance:

    • Structure-based design of compounds targeting plant-specific features of NdhE

    • Identification of natural resistance mutations and their mechanism

    • Development of selective inhibitors for weed control

  • Diagnostic Applications:

    • NdhE-based biosensors for early detection of stress conditions

    • Immunodiagnostic tools to assess plant health status

    • Non-invasive spectroscopic methods for monitoring NdhE activity in situ

These applications could contribute to developing more resilient crop varieties with improved photosynthetic performance under suboptimal conditions, potentially increasing yields by 15-20% in stress-prone environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.