Recombinant Populus trichocarpa Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Populus trichocarpa Photosystem II CP47 Chlorophyll Apoprotein (psbB)

Recombinant Populus trichocarpa Photosystem II CP47 chlorophyll apoprotein (psbB) is a full-length, His-tagged protein (1-508aa) expressed in E. coli or yeast. It is a core component of Photosystem II (PSII), a photosynthetic complex critical for light-driven water oxidation and electron transfer in plants. The recombinant form retains structural and functional fidelity to native CP47, enabling its use in biochemical, structural, and genetic studies .

Role in PSII

CP47 binds chlorophyll and stabilizes the PSII core complex by interacting with the D1/D2 reaction center and cytochrome b559 subunits (psbF/psbL) . It facilitates electron transfer and oxygen evolution, working in tandem with CP43 and the oxygen-evolving complex (OEE) proteins .

Expression Systems and Variants

SystemExpression HostTagApplication FocusSource
Full-lengthE. coliHisStructural studies, functional assays
PartialYeastUndisclosedResearch requiring truncated domains

Key Features:

  • Reconstitution: Requires deionized water (0.1–1.0 mg/mL), with glycerol (5–50%) for stability .

  • Avoidance of Freeze-Thaw Cycles: Critical for maintaining protein integrity .

Critical Interactions in PSII

CP47 interacts with:

  • D1/D2: Core reaction center heterodimer for charge separation .

  • PsbF/PsbL: Cytochrome b559 subunits for electron transfer stabilization .

  • OEE Proteins: 33-kDa, 23-kDa, and 17-kDa subunits for oxygen evolution .

Mutant Studies:

  • hcf243 mutants in Arabidopsis show reduced CP47/D1 accumulation, disrupting PSII supercomplex assembly and oxygen evolution .

  • YAB11 Regulation: YAB11 transcriptionally regulates psbB in Populus, linking leaf morphology to photosynthetic efficiency .

Antibodies and Detection Methods

Antibody TypeHostReactivityApplicationsSource
Polyclonal (AS04 038)RabbitHigher plants, algae, cyanobacteriaWestern blot, native-PAGE
Monoclonal (PHY0058A)RabbitPopulus trichocarpa, ArabidopsisImmunoblotting for PSII subunit detection

Expected MW: ~40–45 kDa (varies by gel system) .

Genetic and Evolutionary Context

  • Gene Conservation: psbB is conserved across plants, algae, and cyanobacteria, with homologs like ATCG00680 in Arabidopsis .

  • Phylogenetic Variations: PtoYAB11 in Populus tomentosa shows a stop-gained mutation, altering transcriptional regulation of psbB and related genes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
psbB; Poptr_cp049; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGTGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAIGWLGHPLFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGSRTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV
Uniprot No.

Target Background

Function

A core component of the photosystem II (PSII) complex. It binds chlorophyll and plays a crucial role in catalyzing the primary light-driven photochemical reactions of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, producing O₂ and a proton gradient subsequently used for ATP synthesis.

Database Links
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of psbB in Populus trichocarpa and how does it compare to other species?

The psbB gene in Populus trichocarpa encodes the CP-47 protein, a critical component of Photosystem II. When comparing across species, significant homology exists between cyanobacterial and plant versions of the gene. For example, the psbB gene from Synechocystis 6803 shows 68% DNA sequence homology with spinach psbB, while the predicted amino acid sequence demonstrates 76% homology .

The hydropathy patterns of CP-47 proteins are remarkably conserved across species, suggesting evolutionary preservation of the protein's folding pattern within the thylakoid membrane . A distinctive feature of the CP-47 protein is the presence of five pairs of histidine residues spaced by 13 or 14 amino acids and located in hydrophobic regions, which are hypothesized to be involved in chlorophyll binding .

What experimental approaches are most effective for studying psbB function in Populus trichocarpa?

Researching psbB function in Populus trichocarpa effectively requires a multi-faceted experimental approach:

  • Gene Cloning and Sequencing: Isolate the psbB gene from the Populus trichocarpa genome using appropriate primers designed from conserved regions. Sequence verification should be performed to confirm the identity of the gene .

  • Gene Interruption Studies: Construct knockout mutants by interrupting the psbB gene with a selectable marker gene (such as kanamycin resistance). This approach has demonstrated that intact CP-47 is required for functional Photosystem II activity .

  • Overexpression Systems: Clone the coding sequence into appropriate expression vectors (such as pBI121) under the control of a constitutive promoter (like 35S promoter) and transform into Agrobacterium for plant transformation .

  • CRISPR-Cas9 Genome Editing: Design guide RNAs targeting specific regions of the psbB gene and introduce them into the plant using Agrobacterium-mediated transformation. This approach allows for precise modifications to study specific domains or residues .

  • Phenotypic Analysis: Measure height, ground diameter, and leaf morphology traits at standard time points (e.g., 120 days after transfer to soil) to assess the physiological impact of psbB modifications .

How does overexpression of psbB affect photosynthetic efficiency and biomass production in Populus trichocarpa?

Overexpression studies involving the related YABBY transcription factor family (which can regulate photosynthetic genes including psbB) demonstrate significant impacts on photosynthetic efficiency and biomass production. When PtoYAB11 was overexpressed in Populus tomentosa, researchers observed:

These results suggest that manipulating transcription factors that regulate psbB and other photosynthetic genes represents a viable strategy for enhancing biomass production in woody plants. The mechanism appears to involve the transcriptional activation of multiple photosynthesis-related genes, creating a synergistic effect on carbon fixation and energy production.

What is the relationship between psbB expression and the functional assembly of Photosystem II in stress conditions?

The relationship between psbB expression and Photosystem II assembly under stress is complex and multifaceted. Research demonstrates that intact CP-47, encoded by psbB, is essential for functional Photosystem II activity . When the psbB gene is interrupted, Photosystem II activity is lost entirely, indicating the critical nature of this protein for photosystem assembly and function .

Under stress conditions, plants must balance the repair and reassembly of damaged Photosystem II complexes. The regulation of psbB expression likely plays a crucial role in this process, though specific mechanisms in Populus trichocarpa remain an active area of investigation.

Experimental approaches to study this relationship should include:

  • Quantitative RT-PCR to measure psbB expression under various stress conditions (drought, high light, temperature extremes)

  • Proteomic analysis of Photosystem II assembly status correlated with psbB expression levels

  • Chlorophyll fluorescence measurements to assess functional impacts on electron transport

What are the optimal molecular biology techniques for creating recombinant psbB constructs in Populus trichocarpa?

Creating effective recombinant psbB constructs in Populus trichocarpa requires careful consideration of several technical aspects:

Vector Selection and Construction:

  • Select an appropriate plant expression vector (such as pBI121) that contains a strong constitutive promoter (35S) for high-level expression .

  • Include proper selection markers (typically kanamycin resistance) to facilitate the identification of transformants .

  • Verify the construct integrity through restriction digestion and sequencing before transformation.

Transformation Protocol:

  • Prepare Agrobacterium strain GV3101 containing the recombinant vector .

  • Infect leaf discs of Populus trichocarpa with the transformed Agrobacterium .

  • Culture on regeneration medium containing appropriate antibiotics.

  • Transfer shoots to proliferation medium .

  • Confirm transformation through PCR and RT-qPCR analysis.

Experimental Controls:

  • Include wild-type (non-transformed) plants grown under identical conditions as negative controls.

  • Consider including plants transformed with empty vector constructs to control for effects of the transformation process itself.

  • Use multiple independent transgenic lines (minimum of three) to account for position effects of transgene insertion .

How should researchers design experiments to evaluate the phenotypic effects of psbB modification?

Designing robust experiments to evaluate phenotypic effects of psbB modification requires comprehensive planning:

Experimental Setup:

  • Grow transgenic and control plants under controlled environmental conditions (light intensity, photoperiod, temperature, humidity).

  • Use a randomized block design to minimize position effects in growth chambers or greenhouses.

  • Include sufficient biological replicates (minimum 3 independent transgenic lines with at least 10 plants per line) .

Phenotypic Measurements:

  • Growth parameters: Measure height and stem diameter at regular intervals (e.g., weekly) up to 120 days after transplantation .

  • Leaf morphology: Document leaf size, shape, margin characteristics, and anatomical features .

  • Photosynthetic parameters: Measure gas exchange, chlorophyll fluorescence, and photosynthetic pigment content.

Data Collection Timeline:
A structured timeline for data collection might include:

  • Day 0: Initial measurements at transplantation

  • Days 30, 60, 90: Intermediate growth measurements

  • Day 120: Final comprehensive phenotypic analysis including destructive sampling for biomass determination

What statistical approaches are most appropriate for analyzing photosynthetic efficiency data in psbB-modified plants?

Analyzing photosynthetic efficiency data from psbB-modified plants requires robust statistical approaches:

  • Normality Testing: Begin with tests for normality (Shapiro-Wilk or Kolmogorov-Smirnov) to determine whether parametric or non-parametric tests are appropriate .

  • Comparative Analysis: For comparing transgenic lines to controls:

    • Paired t-tests when comparing before/after treatments or paired samples

    • ANOVA followed by post-hoc tests (Tukey's HSD) for comparing multiple lines

    • The statistical formula for t-test analysis would be:
      t=Xˉμs/nt = \frac{\bar{X} - \mu}{s/\sqrt{n}}
      where Xˉ\bar{X} is the sample mean, μ\mu is the population mean, ss is the sample standard deviation, and nn is the sample size .

  • Correlation Analysis: Use Pearson's correlation coefficient to examine relationships between photosynthetic parameters and growth measurements.

  • Multivariate Analysis: Consider principal component analysis (PCA) or partial least squares (PLS) for complex datasets with multiple interrelated variables .

  • Time-Series Analysis: For growth and photosynthetic measurements taken over time, repeated measures ANOVA or mixed-effects models are appropriate.

How can researchers resolve contradictory findings regarding psbB function across different experimental systems?

Resolving contradictory findings regarding psbB function requires systematic analysis:

  • Methodology Comparison: Create a comprehensive table comparing experimental methods across studies, including:

    • Plant growth conditions

    • Genetic background of plant material

    • Construct design and promoter strength

    • Measurement techniques and instruments

    • Statistical analysis approaches

  • Cross-Validation: Replicate key experiments using standardized protocols across different laboratories.

  • Meta-Analysis: Conduct statistical meta-analysis of published data to identify consistent trends despite methodological variations.

  • Systematic Review: Perform a structured review of the literature following PRISMA guidelines to identify potential sources of experimental bias.

  • Molecular Confirmation: Verify protein expression and localization using multiple techniques (Western blot, immunolocalization, fluorescent tagging).

What are the most effective strategies for investigating psbB promoter activity and regulation?

Investigating psbB promoter activity and regulation requires sophisticated molecular approaches:

  • Promoter Analysis and Characterization:

    • Identify conserved motifs through bioinformatic analysis

    • Clone various lengths of the promoter region to identify critical regulatory elements

    • Use site-directed mutagenesis to verify functional importance of specific motifs

  • Reporter Gene Assays:

    • Create promoter-reporter fusions (e.g., LUC, GFP) to visualize expression patterns

    • The luciferase (LUC) assay is particularly effective for quantifying promoter activity, as demonstrated in studies of related genes where luminescence intensity directly correlates with transcriptional activation .

  • DNA-Protein Interaction Studies:

    • Yeast one-hybrid (Y1H) assays to identify transcription factors that bind to the psbB promoter

    • Electrophoretic mobility shift assays (EMSA) to provide direct evidence of specific binding in vitro

    • Chromatin immunoprecipitation (ChIP) to verify interactions in vivo

  • Transcription Factor Analysis:

    • Research indicates that transcription factors like YABBY family proteins can bind directly to promoters of photosynthesis-related genes and activate their transcription

    • Co-expression studies can elucidate whether specific transcription factors regulate psbB expression

How can researchers effectively use CRISPR-Cas9 genome editing to study specific domains of the psbB gene product?

CRISPR-Cas9 genome editing offers precise tools for studying psbB domains:

  • Target Site Selection:

    • Use CRISPR-P 2.0 or similar tools to identify potential target sites in the psbB gene

    • Select gRNAs with minimal off-target effects

    • Design editing strategies that target specific functional domains (e.g., chlorophyll-binding histidine pairs)

  • Edit Design Strategies:

    • Knockout mutations: For complete loss-of-function analysis

    • Point mutations: To alter specific amino acids without disrupting the entire protein

    • Domain deletions: To assess the function of specific protein regions

    • Promoter modifications: To alter expression levels without changing protein sequence

  • Transformation and Screening:

    • Transform Populus tissues using Agrobacterium-mediated delivery of Cas9/gRNA constructs

    • Screen transformants using targeted sequencing to identify specific mutations

    • Verify editing outcomes at both DNA and protein levels

  • Phenotypic Analysis Pipeline:

    • Compare photosynthetic parameters between edited and non-edited plants

    • Assess Photosystem II assembly and function through biochemical and biophysical approaches

    • Measure plant growth and development to identify broader physiological impacts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.