Recombinant Populus trichocarpa Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timeframes, please consult your local distributors.
Note: All protein shipments default to standard blue ice packs. If you require dry ice delivery, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we suggest briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To ensure optimal quality, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Poptr_cp001; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O, producing O(2) and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links

KEGG: pop:Poptr_cp001

UniGene: Pth.491

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Populus trichocarpa Photosystem Q(B) protein and what is its role in photosynthesis?

Recombinant Populus trichocarpa Photosystem Q(B) protein, also known as Photosystem II protein D1, is a crucial component of the PSII reaction center. This 344-amino acid protein is encoded by the chloroplast gene psbA and plays a fundamental role in the biogenesis and functional maintenance of Photosystem II. The protein is essential for light-dependent photosynthetic reactions, serving as a key component for electron transport within the thylakoid membrane. D1 protein is highly dynamic under varying light conditions, requiring efficient synthesis mechanisms to maintain photosynthetic efficiency and protect against photodamage .

How is the psbA gene regulated in Populus trichocarpa?

The psbA gene (designated as Poptr_cp001 in Populus trichocarpa) is regulated through complex mechanisms that respond to light conditions and environmental stresses. Research has shown that expression of psbA mRNA and subsequent D1 protein synthesis is light-dependent, involving specific regulatory proteins that bind to the 5' UTR of psbA mRNA. In higher plants, proteins like LPE1 bind to the 5′ UTR of psbA mRNA in a light-dependent manner through a redox-based mechanism and facilitate the association of proteins such as HCF173 with psbA mRNA to regulate D1 translation. This mechanism represents an important adaptation for plants to adjust photosynthetic capacity in response to changing light conditions, which is particularly relevant for trees such as Populus that grow in varied light environments .

What are the optimal storage and handling conditions for recombinant Photosystem Q(B) protein?

For optimal preservation of recombinant Photosystem Q(B) protein activity, the following storage and handling protocols are recommended:

Storage ParameterRecommendation
Long-term storage-20°C to -80°C
Working aliquot storage4°C for up to one week
PreparationAliquot upon receipt to avoid freeze-thaw cycles
Buffer compositionTris/PBS-based buffer, pH 8.0 with 6-50% Trehalose or glycerol
ReconstitutionUse deionized sterile water to concentration of 0.1-1.0 mg/mL
Pre-use preparationBrief centrifugation before opening
StabilizationAdd 5-50% glycerol (final concentration) for long-term storage

Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce protein activity. For experimental procedures requiring multiple uses, it is advisable to prepare smaller working aliquots stored at 4°C that can be used within one week .

How can I optimize the expression and purification of recombinant Photosystem Q(B) protein in E. coli systems?

Optimizing expression and purification of Photosystem Q(B) protein in E. coli requires careful consideration of several factors:

  • Expression system selection: Use E. coli strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3)).

  • Expression vector design: Include an N-terminal His-tag for affinity purification while ensuring the tag doesn't interfere with protein folding.

  • Culture conditions optimization:

    • Grow cultures at lower temperatures (16-20°C) after induction

    • Use lower IPTG concentrations (0.1-0.5 mM)

    • Extend expression time (18-24 hours)

    • Supplement media with specific cofactors or stabilizers

  • Lysis and solubilization protocol:

    • Use gentle lysis methods to prevent protein aggregation

    • Include appropriate detergents (DDM or LDAO) for membrane protein solubilization

    • Maintain buffer pH between 7.5-8.0 to preserve protein stability

  • Purification strategy:

    • Employ immobilized metal affinity chromatography (IMAC) using the His-tag

    • Follow with size exclusion chromatography for higher purity

    • Maintain detergent above critical micelle concentration throughout purification

  • Quality assessment:

    • Verify purity by SDS-PAGE (should be >90%)

    • Confirm identity by mass spectrometry or western blotting

    • Assess functionality through specific activity assays

What methods are effective for studying subcellular localization of Photosystem Q(B) protein?

Several methods can be employed to study the subcellular localization of Photosystem Q(B) protein, with the following techniques providing complementary information:

  • Fluorescent protein fusion approach:

    • Create C-terminal or N-terminal eGFP fusions with the Photosystem Q(B) protein

    • Clone the coding sequence into appropriate vectors (e.g., pCsVMV-eGFP-N-999)

    • Introduce the construct into plant protoplasts using polyethylene glycol method

    • Visualize localization using confocal laser scanning microscopy

  • Immunocytochemistry/Immunohistochemistry:

    • Develop specific antibodies against the Photosystem Q(B) protein

    • Fix and permeabilize plant tissue or isolated chloroplasts

    • Apply primary antibodies followed by fluorescently-labeled secondary antibodies

    • Visualize using confocal or super-resolution microscopy

  • Subcellular fractionation:

    • Isolate intact chloroplasts from plant material

    • Further separate thylakoid membranes, stroma, and other chloroplast compartments

    • Analyze fractions by western blotting using specific antibodies

    • Quantify protein distribution across compartments

  • Electron microscopy with immunogold labeling:

    • Prepare ultrathin sections of plant tissue

    • Label with specific antibodies against Photosystem Q(B) protein

    • Apply gold-conjugated secondary antibodies

    • Visualize using transmission electron microscopy for precise localization

How does light intensity affect the turnover and replacement of Photosystem Q(B) protein in Populus trichocarpa?

The Photosystem Q(B) protein (D1) in Populus trichocarpa exhibits one of the highest turnover rates among thylakoid membrane proteins, particularly under high light conditions. Research indicates that this dynamic is essential for maintaining photosynthetic efficiency and preventing photoinhibition.

The turnover mechanism follows a complex pattern:

  • Light intensity correlation: As light intensity increases, D1 protein damage accelerates due to reactive oxygen species production at the PSII reaction center. Under high light, turnover rates can increase 10-50 fold compared to moderate light conditions.

  • Repair cycle dynamics: The D1 repair cycle involves multiple steps:

    • Damaged D1 detection and targeting

    • Partial disassembly of PSII

    • Proteolytic degradation of damaged D1

    • Synthesis of new D1 protein

    • Reassembly of functional PSII complexes

  • Transcriptional vs. translational regulation: While psbA transcript levels show modest changes with light intensity, translational regulation is the primary control point. Light-dependent regulatory factors interact with the 5' UTR of psbA mRNA to modulate translation efficiency.

  • Species-specific adaptations: Populus trichocarpa, as a tree species exposed to variable light conditions throughout its canopy, has evolved potentially unique regulatory mechanisms compared to herbaceous plants. This includes specialized translation factors and chaperones that facilitate rapid D1 replacement under fluctuating light conditions .

Experimental approaches to study this phenomenon include pulse-chase labeling with radioactive amino acids, quantitative proteomics, and the use of photoinhibition recovery assays under controlled light conditions.

What molecular mechanisms regulate the light-dependent translation of psbA mRNA in Populus trichocarpa?

The light-dependent translation of psbA mRNA in Populus trichocarpa involves sophisticated molecular mechanisms that integrate light signals with translation machinery. Several key components of this regulatory system have been identified:

  • RNA-binding proteins: Specific RNA-binding proteins interact with the 5' UTR of psbA mRNA in a light-dependent manner. These proteins include:

    • LPE1 (LOW PHOTOSYNTHETIC EFFICIENCY 1), which binds directly to the 5' UTR of psbA mRNA

    • HCF173 (HIGH CHLOROPHYLL FLUORESCENCE 173), which associates with psbA mRNA to facilitate translation

  • Redox-based regulation: The binding of regulatory proteins to psbA mRNA is modulated by the redox state of the chloroplast, which changes in response to light conditions. This involves:

    • Thioredoxin-mediated reduction of regulatory proteins

    • Conformational changes in RNA-binding proteins that affect their affinity for psbA mRNA

    • Integration of electron transport chain status with translation initiation

  • Ribosome recruitment: The initiation of translation requires:

    • Recruitment of chloroplast ribosomes to the psbA mRNA

    • Assembly of translation initiation complexes

    • Coordination with membrane insertion machinery for proper D1 protein integration

  • Co-translational assembly: Evidence suggests that D1 translation is coordinated with PSII assembly through:

    • Spatial organization of translation near thylakoid membranes

    • Coordination with chlorophyll synthesis

    • Interaction with assembly factors during translation

This complex regulatory network ensures that D1 protein synthesis responds appropriately to changing light conditions, balancing the need for replacement of damaged proteins while preventing wasteful synthesis under unfavorable conditions.

How do mutations in the psbA gene affect Photosystem II function and plant performance under stress conditions?

Mutations in the psbA gene can significantly alter Photosystem II function and plant stress responses in Populus trichocarpa and other plants. These mutations provide valuable insights into structure-function relationships and adaptation mechanisms:

  • Impact on photosynthetic efficiency:

    • Mutations in crucial amino acids within the D1 protein can reduce quantum yield of PSII

    • Alterations in the QB binding pocket affect electron transfer rates

    • Changes in transmembrane domains can disrupt protein-protein interactions within PSII

  • Stress tolerance modifications:

    • Certain psbA mutations confer increased tolerance to specific stresses:

      • Herbicide resistance (particularly to triazine-class herbicides)

      • Modified sensitivity to high light stress

      • Altered temperature tolerance ranges

    • The trade-off typically involves reduced photosynthetic efficiency under optimal conditions

  • D1 protein turnover alterations:

    • Mutations can affect the recognition of damaged D1 by proteases

    • Changes in D1 structure may accelerate or decelerate protein degradation rates

    • Mutation-induced conformational changes can impact the efficiency of the repair cycle

  • Downstream signaling effects:

    • D1 protein status serves as a sensor for chloroplast stress

    • Mutations can alter retrograde signaling from chloroplast to nucleus

    • This affects expression of nuclear-encoded photosynthetic genes and stress response pathways

Research approaches to study these relationships include site-directed mutagenesis in model systems, chlorophyll fluorescence analysis, and comparative analysis of natural variants of the psbA gene. Understanding these relationships has implications for developing plants with enhanced stress tolerance while maintaining productivity .

What are the most effective methods for analyzing Photosystem Q(B) protein turnover in vivo?

Analyzing Photosystem Q(B) protein turnover in vivo requires specialized techniques that can track protein synthesis and degradation in living plant systems. The following methodologies have proven most effective:

  • Pulse-chase isotopic labeling:

    • Incorporate radioactive (35S-methionine) or stable isotope labeled amino acids during a brief "pulse" period

    • Chase with non-labeled amino acids

    • Extract and analyze D1 protein at various time points

    • Quantify labeled protein decay to determine half-life

    • Advantages: Direct measurement of protein turnover; high sensitivity

    • Limitations: Requires radioisotope handling; invasive sampling

  • Fluorescent protein tagging with photoconvertible proteins:

    • Generate fusion constructs with photoconvertible fluorescent proteins (e.g., Dendra2)

    • Convert existing protein pool from green to red fluorescence

    • Track degradation of red signal and appearance of new green signal

    • Advantages: Non-invasive; allows subcellular resolution

    • Limitations: Tag may affect protein function; background autofluorescence

  • SUnSET technique (Surface Sensing of Translation):

    • Apply puromycin (translation elongation inhibitor) at low concentrations

    • Detect newly synthesized proteins containing puromycin using anti-puromycin antibodies

    • Combine with D1-specific antibodies for immunoprecipitation

    • Advantages: No need for transgenic modification; measures actual translation rates

    • Limitations: Short treatment windows; potential side effects

  • Quantitative mass spectrometry approaches:

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture)

    • Dynamic SILAC to measure synthesis and degradation rates

    • Selected/Multiple Reaction Monitoring (SRM/MRM) for targeted quantification

    • Advantages: Highly accurate; can measure multiple proteins simultaneously

    • Limitations: Requires sophisticated equipment; complex data analysis

These techniques can be combined with environmental manipulations (light intensity, temperature, drought) to assess how stress conditions affect D1 protein turnover dynamics, providing insights into adaptive mechanisms in Populus trichocarpa .

How can researchers effectively distinguish between different isoforms and modified forms of the Photosystem Q(B) protein?

Distinguishing between isoforms and post-translationally modified forms of Photosystem Q(B) protein requires a combination of high-resolution analytical techniques:

  • High-resolution mass spectrometry:

    • Top-down proteomics approach to analyze intact proteins

    • Bottom-up approach using enzymatic digestion followed by LC-MS/MS

    • Targeted Multiple Reaction Monitoring for specific modifications

    • Data analysis parameters:

      ParameterSetting
      Mass accuracy<5 ppm
      Resolution>60,000 FWHM
      FragmentationHCD and ETD combined
      DatabaseSpecies-specific with known modifications
  • 2D-PAGE combined with western blotting:

    • First dimension: Isoelectric focusing

    • Second dimension: SDS-PAGE

    • Transfer to membrane and probe with specific antibodies

    • Different isoforms/modifications appear as distinct spots

  • Site-specific antibodies:

    • Develop antibodies against known modification sites

    • Use for western blotting or immunoprecipitation

    • Enables tracking of specific modifications under different conditions

  • Liquid chromatography techniques:

    • Ion-exchange chromatography to separate based on charge differences

    • Hydrophobic interaction chromatography for subtle structural variations

    • Affinity chromatography using modification-specific binding partners

  • Bioinformatic analysis pipeline:

    • Sequence alignment of isoforms

    • Prediction of potential modification sites

    • Molecular modeling to assess structural impacts of modifications

    • Custom database creation for mass spectrometry analysis

These techniques allow researchers to characterize the dynamic changes in Photosystem Q(B) protein population, including phosphorylation, oxidation, and other modifications that occur in response to light conditions and environmental stresses .

How can researchers address issues with low yield and poor solubility when working with recombinant Photosystem Q(B) protein?

Photosystem Q(B) protein, being a membrane protein, presents significant challenges in terms of yield and solubility when expressed recombinantly. The following approaches can help address these issues:

  • Expression system optimization:

    • Try multiple E. coli strains specifically designed for membrane proteins (C41, C43, BL21-AI)

    • Consider cell-free expression systems which can produce membrane proteins in the presence of detergents or lipids

    • Evaluate alternative expression hosts such as Pichia pastoris for eukaryotic processing

  • Vector and construct design improvements:

    • Optimize codon usage for the expression host

    • Test different fusion partners (MBP, SUMO, Trx) to enhance solubility

    • Design constructs with and without transit peptide sequences

    • Consider dual-tagging strategies for improved purification

  • Expression condition modifications:

    ParameterStandard ConditionOptimized Condition
    Temperature37°C16-20°C
    IPTG concentration1.0 mM0.1-0.3 mM
    MediaLBTerrific Broth or Auto-induction
    Induction timingMid-log phaseLate-log phase
    Expression duration4-6 hours16-24 hours
    AdditivesNone1% glucose, 10% glycerol
  • Solubilization and purification strategies:

    • Screen multiple detergents (DDM, LDAO, FC-12) for optimal solubilization

    • Test detergent mixtures and amphipols for stability

    • Incorporate lipids during purification to maintain native-like environment

    • Use gradient purification methods to prevent protein aggregation

    • Consider on-column refolding techniques

  • Storage and stability enhancement:

    • Add stabilizing agents (glycerol, specific lipids, reducing agents)

    • Maintain protein at higher concentrations to prevent aggregation

    • Store in small aliquots to minimize freeze-thaw cycles

    • Consider lyophilization with appropriate excipients for long-term storage

What are the most common artifacts in Photosystem II functionality assays and how can they be controlled?

Photosystem II functionality assays can be prone to various artifacts that may lead to misinterpretation of results. Researchers should be aware of these potential issues and implement appropriate controls:

By implementing these controls and being aware of common artifacts, researchers can ensure more reliable and reproducible measurements of Photosystem II activity in both native and recombinant systems .

What are the emerging technologies and approaches for studying Photosystem Q(B) protein dynamics in situ?

Emerging technologies are revolutionizing our ability to study Photosystem Q(B) protein dynamics under native conditions with unprecedented resolution:

  • Advanced microscopy techniques:

    • Single-molecule localization microscopy (PALM/STORM) for super-resolution imaging

    • Adaptive optics for deep tissue imaging in intact leaves

    • Light sheet microscopy for rapid 3D imaging with reduced photodamage

    • Cryo-electron tomography of flash-frozen chloroplasts to capture native states

  • Time-resolved spectroscopy advances:

    • Ultrafast transient absorption spectroscopy with femtosecond resolution

    • Time-resolved X-ray crystallography at free electron laser facilities

    • Raman microscopy with subcellular resolution for conformational analysis

    • 2D electronic spectroscopy to map energy transfer pathways

  • In vivo labeling and tracking methods:

    • Site-specific incorporation of non-canonical amino acids for bioorthogonal chemistry

    • Split fluorescent protein complementation to study protein-protein interactions

    • Optogenetic approaches to control protein function with light

    • MINFLUX nanoscopy for tracking single proteins with nanometer precision

  • Computational integration approaches:

    • Molecular dynamics simulations of entire PSII complexes in membrane environments

    • Machine learning algorithms for pattern recognition in complex datasets

    • Multi-scale modeling linking quantum effects to whole-chloroplast function

    • Digital twin development for predictive modeling of photosynthetic response

These technologies are enabling researchers to address fundamental questions about D1 protein dynamics that were previously inaccessible, including conformational changes during the water-splitting cycle, the spatial organization of repair mechanisms, and the nanoscale movements of proteins within the thylakoid membrane .

How might genetic engineering of Photosystem Q(B) protein improve photosynthetic efficiency in crop species?

Targeted genetic engineering of Photosystem Q(B) protein (D1) offers promising approaches to enhance photosynthetic efficiency in crop species, with several strategies showing particular potential:

  • Engineering D1 variants with improved stress tolerance:

    • Targeted amino acid substitutions to enhance electron transport under high temperature

    • Modifications to reduce susceptibility to photoinhibition

    • Alterations in D1 turnover rates to better balance repair with energy expenditure

    • Expected outcome: 15-30% improvement in photosynthetic efficiency under fluctuating field conditions

  • Optimizing D1 protein turnover dynamics:

    • Engineering the psbA gene regulatory elements for faster recovery from photodamage

    • Modifying protease recognition sites to optimize degradation of damaged D1

    • Enhancing translation efficiency under stress conditions

    • Expected outcome: Reduced photoinhibition recovery time from hours to minutes

  • Cross-species optimization approaches:

    • Incorporating beneficial D1 protein features from extremophile organisms

    • Creating chimeric proteins with domains optimized for specific environmental challenges

    • Systematic testing of natural D1 variants from diverse ecosystems

    • Expected outcome: Novel photosynthetic properties adapted to specific agricultural environments

  • Integration with other photosynthetic enhancements:

    • Coordinated engineering of D1 with carbon fixation pathways

    • Optimization of D1 variants for altered pigment compositions

    • Synchronizing D1 kinetics with photoprotection mechanisms

    • Expected outcome: Synergistic improvements exceeding those of single-target approaches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.