Recombinant Porcine epidemic diarrhea virus Membrane protein (M)

Shipped with Ice Packs
In Stock

Description

Definition and Production of Recombinant PEDV M Protein

The recombinant Porcine Epidemic Diarrhea Virus (PEDV) Membrane (M) protein is a genetically engineered version of the native M protein, expressed in heterologous systems such as Escherichia coli or mammalian cells. This protein is critical for viral assembly, immune modulation, and vaccine development. Key production steps include:

  • Cloning: The M gene is cloned into expression vectors (e.g., pET or pcDNA).

  • Expression: Recombinant M protein is produced in E. coli or mammalian cells, with E. coli being the most common due to cost efficiency .

  • Purification: Affinity chromatography (e.g., His-tag purification) isolates the protein for downstream applications .

Table 2: Predicted Epitopes in PEDV M Protein

Epitope TypeExample SequencesConservationSource
Linear B-cellRSVNASSGTG, KHGDYSAVSNPSALTHigh
Discontinuous B-cellMultiple discontinuous regionsModerate
T-cell (Strong)14 epitopes identifiedVariable

Functional Roles

  1. Viral Assembly:

    • Forms homodimers to scaffold viral envelopes .

    • Interacts with S (spike), E (envelope), and N (nucleocapsid) proteins .

  2. Immune Modulation:

    • IFN Suppression: Binds IRF7’s inhibitory domain, blocking TBK1/IKKε-mediated phosphorylation and dimerization .

    • Host Protein Interactions: Associates with 218 cellular proteins, including eIF3L (translation factor) and cyclin A (cell cycle regulation) .

Table 3: Host Proteins Interacting with PEDV M Protein

Host ProteinFunctional PathwayImpact on Viral ReplicationSource
IRF7Type I IFN signalingSuppresses IFN-β production
eIF3LTranslation initiationDownregulation increases PEDV yield
Cyclin ACell cycle regulationInduces S-phase arrest

Diagnostic Use

The recombinant M protein serves as a specific antigen in enzyme-linked immunosorbent assays (ELISA):

  • Specificity: Detects PEDV antibodies without cross-reactivity with TGEV, IBV, or PRRSV .

  • Sensitivity: Detects PEDV in infected cell lysates via immunofluorescence .

Vaccine Development

The M protein’s conserved epitopes make it a prime candidate for subunit vaccines:

  • Linear B-Cell Epitopes: RSVNASSGTG and KHGDYSAVSNPSALT show high conservation across PEDV strains .

  • T-Cell Epitopes: 40 weak and 14 strong T-cell epitopes identified, with potential for broad immune activation .

Table 4: Advantages of M Protein-Based Vaccines

AdvantageRationaleSource
Cross-Strain ProtectionEpitope conservation across G1 and G2 genogroups
Reduced Virulence RiskNon-replicative, recombinant format reduces safety concerns

Challenges and Future Directions

  1. Structural Elucidation: Experimental validation of the 3D model is needed to refine epitope targeting .

  2. Epitope Validation: Functional testing of predicted epitopes (e.g., neutralization assays) is critical for vaccine design .

  3. Therapeutic Targets: Inhibiting M-IRF7 interactions could restore IFN responses, offering antiviral strategies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
M; 5; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Porcine epidemic diarrhea virus (strain Br1/87) (PEDV)
Target Names
M
Target Protein Sequence
MSNGSIPVDEVIEHLRNWNFTWNIILTILLVVLQYGHYKYSVFLYGVKMAILWILWPLVL ALSLFDAWASFQVNWVFFAFSILMACITLMLWIMYFVNSIRLWRRTHSWWSFNPETDALL TTSVMGRQVCIPVLGAPTGVTLTLLSGTLLVEGYKVATGVQVSQLPNFVTVAKATTTIVY GRVGRSVNASSGTGWAFYVRSKHGDYSAVSNPSAVLTDSEKVPHLV
Uniprot No.

Target Background

Function
A viral envelope component crucial for virus morphogenesis and assembly through interactions with other viral proteins.
Protein Families
Alphacoronaviruses M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the PEDV M protein and what is its significance in viral research?

The membrane (M) protein is one of the four main structural proteins of Porcine Epidemic Diarrhea Virus, a highly pathogenic coronavirus that causes severe enteritis and lethal watery diarrhea in piglets, with mortality rates reaching up to 100% in neonatal piglets . The M protein is significant in viral research for several reasons:

  • It plays crucial roles in virus assembly and budding

  • It demonstrates strong immunogenicity, making it useful for diagnostic development

  • It functions as an antagonist of type I interferon production, representing an important viral immune evasion mechanism

  • It serves as a promising target for developing detection methods such as ELISA, RT-qPCR, and RT-PCR

The M protein's central role in PEDV pathogenesis and immune modulation makes it an important focus for both fundamental virology research and applied vaccine/diagnostic development.

How can the PEDV M protein be expressed in prokaryotic systems?

The PEDV M protein can be successfully expressed in prokaryotic systems, particularly Escherichia coli, through the following methodological approach:

  • Gene preparation: The signal peptide sequence-deleted M gene should be amplified using PCR with primers containing appropriate restriction enzyme sites (e.g., EcoRI and XhoI)

  • Vector construction: The amplified gene should be cloned into a prokaryotic expression vector such as pET-30a, resulting in a recombinant plasmid (e.g., pET-PEDV-M)

  • Expression conditions: Optimal expression can be achieved using 0.5 mM IPTG induction at 37°C. The protein expression becomes detectable as early as 1 hour post-induction

  • Protein characteristics: The M protein typically expresses as inclusion bodies in recombinant E. coli with an approximate molecular weight of 27 kDa

  • Purification: Standard protein purification methods suitable for inclusion bodies can be applied to isolate the recombinant protein

This prokaryotic expression system offers an efficient method for producing significant quantities of PEDV M protein for research applications, including antibody production and diagnostic development.

What detection methods can be developed using recombinant PEDV M protein?

Recombinant PEDV M protein can serve as the foundation for developing several highly specific detection methods:

  • ELISA-based assays: The purified recombinant M protein can be used to immunize laboratory animals (e.g., rabbits) to generate polyclonal antibodies. These antibodies can then be utilized to develop indirect ELISA tests that specifically detect PEDV with no cross-reactivity to other viruses such as porcine transmissible gastroenteritis coronavirus (TGEV), avian infectious bronchitis coronavirus, porcine reproductive and respiratory syndrome virus (PRRSV), classic swine fever virus, and porcine pseudorabies virus

  • Immunofluorescence assays: Anti-PEDV-M antibodies can be employed in immunofluorescence tests to visualize PEDV infection in cell cultures. Studies have confirmed that antibodies raised against recombinant M protein can effectively detect the virus in infected cells

  • Western blot analysis: Anti-M antibodies can be used in Western blot applications to specifically detect the presence of PEDV M protein in research and diagnostic samples

  • Molecular detection methods: The M gene sequence can inform the design of primers for RT-PCR and RT-qPCR assays to detect PEDV RNA in clinical specimens

The high specificity of M protein-based detection systems makes them valuable tools for both research and diagnostic applications in the field of veterinary virology.

How does the PEDV M protein interact with the host innate immune system?

The PEDV M protein serves as a critical viral antagonist of host innate immunity through sophisticated molecular mechanisms:

  • Type I interferon inhibition: The M protein has been identified as a potent inhibitor of type I interferon (IFN) production in both human (HEK293T) and porcine (PK-15) cell lines

  • IRF7 interaction mechanism: The M protein specifically targets the innate immune pathway by:

    • Directly interacting with the inhibitory domain (ID) of IFN regulatory factor 7 (IRF7)

    • Significantly suppressing TBK1/IKKε-induced IRF7 phosphorylation

    • Inhibiting dimerization of IRF7, which is essential for its transcriptional activity

    • These effects lead to decreased expression of type I IFN

  • Functional domains: The 1-55 amino acid region of the M protein is essential for disrupting IRF7 function through direct protein-protein interaction

  • Conservation of function: Both epidemic PEDV strains and vaccine strain M proteins demonstrate similar antagonistic effects on type I IFN production, suggesting this immune evasion mechanism is evolutionarily conserved

  • Impact on viral replication: Experimental overexpression of M protein significantly increases PEDV replication in porcine cells, highlighting the protein's contribution to viral pathogenesis

This complex interaction between the PEDV M protein and host innate immunity represents an important viral strategy for evading host defenses and promoting efficient viral replication.

What are the key considerations for designing immunogens based on PEDV M protein for vaccine development?

Designing effective immunogens based on PEDV M protein for vaccine development requires careful consideration of several critical factors:

  • Epitope selection and preservation:

    • Identify immunodominant and neutralizing epitopes within the M protein

    • Ensure epitopes are conserved across various PEDV strains to provide cross-protection

    • Consider combining M protein epitopes with epitopes from other structural proteins (like S protein) for broader immunity

  • Expression system optimization:

    • Remove signal peptide sequences that may interfere with proper recombinant expression

    • Select appropriate expression vectors and host systems to ensure correct protein folding

    • Optimize codon usage for maximum expression in the selected system

  • Adjuvant selection:

    • Test different adjuvant formulations to enhance immune responses against the M protein

    • Consider mucosal adjuvants that can promote intestinal immunity, the primary site of PEDV infection

  • Delivery method development:

    • Explore oral delivery systems to stimulate mucosal immunity in the intestinal tract

    • Evaluate maternal vaccination strategies to provide passive immunity to neonatal piglets through colostrum and milk

  • Immunogenicity evaluation:

    • Assess both humoral and cell-mediated immune responses

    • Measure neutralizing antibody titers and duration of protection

    • Evaluate cross-protection against heterologous PEDV strains

  • Safety considerations:

    • Ensure the absence of adverse reactions at the injection site

    • Confirm the absence of unintended immunomodulatory effects due to the M protein's natural role in interferon suppression

These considerations are essential for developing M protein-based vaccines that can effectively contribute to PEDV prevention and control strategies.

How can protein-protein interaction studies be designed to investigate PEDV M protein's role in viral assembly?

Investigating the PEDV M protein's role in viral assembly requires sophisticated protein-protein interaction studies designed with the following methodological considerations:

  • Co-immunoprecipitation (Co-IP) assays:

    • Express tagged versions of M protein along with other viral structural proteins (S, E, N)

    • Use specific antibodies against the tags or proteins to pull down protein complexes

    • Analyze precipitated proteins by Western blot or mass spectrometry to identify interacting partners

    • Include appropriate controls with mutations in potential interaction domains

  • Yeast two-hybrid (Y2H) screening:

    • Construct bait plasmids containing the M protein or specific domains

    • Screen against prey libraries of other viral proteins or host cellular proteins

    • Validate positive interactions through reciprocal Y2H assays and alternative methods

    • Map interaction domains through truncation or point mutation analyses

  • Bimolecular fluorescence complementation (BiFC):

    • Fuse fragments of fluorescent proteins to the M protein and potential interacting partners

    • Visualize interactions through reconstituted fluorescence when proteins come into proximity

    • Conduct real-time studies of protein interactions in living cells

    • Correlate interaction locations with subcellular compartments involved in virus assembly

  • Proximity ligation assays (PLA):

    • Detect protein-protein interactions with high sensitivity and specificity in fixed cells

    • Visualize the subcellular localization of interactions during different stages of viral replication

    • Quantify interaction signals to assess the strength of various protein associations

  • Time-course experiments:

    • Monitor protein interactions at different time points post-infection or transfection

    • Correlate interaction patterns with different stages of the viral replication cycle

    • Assess how interactions change during virus particle formation and budding

These methodological approaches can provide valuable insights into the molecular mechanisms by which the PEDV M protein orchestrates viral assembly and interacts with other viral and cellular components.

What methods can be used to evaluate the impact of M protein mutations on PEDV virulence?

Evaluating the impact of M protein mutations on PEDV virulence requires a multi-faceted experimental approach:

  • Reverse genetics systems:

    • Generate recombinant PEDV strains with specific M protein mutations using targeted RNA recombination or CRISPR-Cas9 technology

    • Create a panel of viruses with mutations in different functional domains of the M protein

    • Include appropriate wild-type and deletion controls for comparative analyses

  • In vitro characterization:

    • Assess growth kinetics in relevant cell lines (e.g., Vero, IPEC-J2) by measuring viral titers at different time points

    • Evaluate cytopathic effects and cell viability to determine cytotoxicity

    • Measure interferonogenic capacity by quantifying type I IFN production in infected cells

    • Analyze the impact on viral RNA and protein synthesis through qRT-PCR and Western blotting

  • Type I interferon antagonism assays:

    • Perform luciferase reporter assays with IFN-β promoter constructs to measure the impact of M protein variants on IFN signaling

    • Assess IRF7 phosphorylation and dimerization in the presence of different M protein mutants

    • Quantify expression levels of interferon-stimulated genes (ISGs) using qRT-PCR or RNA-seq

  • Protein localization and trafficking studies:

    • Conduct immunofluorescence microscopy to determine if mutations affect subcellular localization

    • Perform pulse-chase experiments to assess the stability and trafficking of mutant M proteins

    • Use fluorescently tagged proteins to monitor real-time trafficking in living cells

  • In vivo pathogenesis studies:

    • Inoculate susceptible piglets with recombinant viruses carrying M protein mutations

    • Monitor clinical signs, including diarrhea severity, dehydration, and mortality rates

    • Measure viral shedding in feces using qRT-PCR and virus isolation

    • Conduct histopathological analyses of intestinal tissues to assess tissue damage

    • Evaluate immune responses by measuring neutralizing antibody titers and cytokine profiles

This comprehensive approach enables researchers to establish clear correlations between specific M protein mutations and alterations in PEDV virulence, potentially identifying key determinants for rational vaccine design.

What is the optimal protocol for purifying recombinant PEDV M protein from E. coli?

The purification of recombinant PEDV M protein from E. coli requires a carefully optimized protocol to ensure high yield and purity:

  • Bacterial culture and induction:

    • Grow transformed E. coli (containing pET-PEDV-M or similar construct) in appropriate media (e.g., LB with antibiotics)

    • Induce protein expression with 0.5 mM IPTG when culture reaches OD600 of 0.6-0.8

    • Continue incubation at 37°C for 4-6 hours (protein expression is detectable from 1 hour post-induction)

  • Cell harvesting and lysis:

    • Collect bacterial cells by centrifugation at 5,000 × g for 10 minutes at 4°C

    • Resuspend pellet in lysis buffer (typically containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, 1% Triton X-100, and protease inhibitors)

    • Lyse cells by sonication or using a French press

    • Centrifuge lysate at 12,000 × g for 30 minutes at 4°C to separate soluble and insoluble fractions

  • Inclusion body processing:

    • Since PEDV M protein typically forms inclusion bodies, resuspend the insoluble pellet in denaturation buffer (8 M urea, 50 mM Tris-HCl pH 8.0, 100 mM NaCl, 10 mM imidazole)

    • Incubate with gentle agitation for 1 hour at room temperature

    • Centrifuge at 12,000 × g for 30 minutes at 4°C to remove insoluble debris

  • Affinity chromatography:

    • If using His-tagged M protein, load the clarified denatured protein onto a Ni-NTA column pre-equilibrated with denaturation buffer

    • Wash extensively with washing buffer (8 M urea, 50 mM Tris-HCl pH 8.0, 100 mM NaCl, 20 mM imidazole)

    • Elute purified protein with elution buffer (8 M urea, 50 mM Tris-HCl pH 8.0, 100 mM NaCl, 250 mM imidazole)

  • Protein refolding:

    • Perform step-wise dialysis to remove urea and allow protein refolding

    • Start with 4 M urea buffer, followed by 2 M, 1 M, and finally 0 M urea in 50 mM Tris-HCl pH 8.0, 150 mM NaCl

    • Each dialysis step should be performed for at least 4 hours at 4°C

  • Quality control:

    • Verify protein purity by SDS-PAGE (expected size approximately 27 kDa)

    • Confirm identity by Western blot using anti-His tag antibody or specific anti-PEDV M antibody

    • Determine protein concentration using Bradford or BCA assay

    • Assess biological activity through functional assays (e.g., antibody recognition)

This optimized protocol yields purified recombinant PEDV M protein suitable for immunization, antibody production, and development of diagnostic assays.

How can the immunogenicity of recombinant PEDV M protein be evaluated?

Evaluating the immunogenicity of recombinant PEDV M protein requires a comprehensive testing strategy:

  • Animal immunization protocols:

    • Select appropriate animal models (rabbits for polyclonal antibodies; mice for monoclonal antibodies)

    • Prepare immunization formulation (typically 100-500 μg of purified M protein with complete Freund's adjuvant for primary immunization)

    • Administer primary immunization followed by 2-3 booster doses at 2-3 week intervals using incomplete Freund's adjuvant

    • Collect serum samples before immunization (pre-immune) and after each booster

  • Antibody titer determination:

    • Develop an indirect ELISA using the recombinant M protein as coating antigen

    • Perform serial dilutions of immune sera to determine endpoint titers

    • Include appropriate positive and negative controls

    • Calculate antibody titers based on the highest dilution giving a positive result (reported titers can reach 1:10^12 for anti-PEDV-M antibodies)

  • Antibody specificity assessment:

    • Perform Western blot analysis using recombinant M protein and PEDV-infected cell lysates

    • Conduct immunofluorescence assays on PEDV-infected cells to verify antibody recognition of native viral proteins

    • Test cross-reactivity against related coronaviruses (e.g., TGEV) and other porcine viruses to confirm specificity

  • Functional antibody testing:

    • Evaluate virus neutralization capacity using plaque reduction neutralization tests

    • Assess antibody-dependent cell-mediated cytotoxicity (ADCC)

    • Determine complement-dependent cytotoxicity (CDC)

    • Measure antibody-dependent enhancement (ADE) potential

  • Epitope mapping:

    • Generate a library of overlapping peptides spanning the M protein sequence

    • Identify immunodominant linear epitopes using peptide ELISA or peptide arrays

    • Confirm epitope recognition using competition assays

    • Assess conservation of identified epitopes across PEDV strains

  • Cellular immunity assessment:

    • Isolate peripheral blood mononuclear cells (PBMCs) from immunized animals

    • Perform lymphocyte proliferation assays upon M protein restimulation

    • Measure cytokine production profiles (IFN-γ, IL-4, IL-10, etc.) using ELISA or ELISPOT

    • Characterize T-cell responses using flow cytometry

This comprehensive evaluation approach provides detailed insights into both the humoral and cellular immune responses elicited by recombinant PEDV M protein, informing its potential utility in diagnostic and vaccine applications.

What are common challenges in expressing PEDV M protein in prokaryotic systems and how can they be addressed?

Researchers frequently encounter several challenges when expressing PEDV M protein in prokaryotic systems, with effective solutions requiring specific technical approaches:

ChallengeUnderlying CausesSolution Strategies
Low expression yield- Codon bias
- Protein toxicity
- mRNA secondary structures
- Use codon-optimized gene sequences
- Employ expression vectors with tight regulation (e.g., pET system)
- Optimize bacterial growth conditions (temperature, media, induction timing)
- Consider lower IPTG concentrations (0.1-0.5 mM) and reduced induction temperature (16-30°C)
Inclusion body formation- Rapid expression rates
- Improper protein folding
- Hydrophobic regions
- Express at lower temperatures (16-25°C)
- Use solubility-enhancing fusion tags (SUMO, GST, MBP)
- Co-express with molecular chaperones
- Alternatively, develop optimized protocols for inclusion body processing
Protein degradation- Host proteases
- Protein instability
- Add protease inhibitors during purification
- Use protease-deficient E. coli strains
- Optimize buffer conditions (pH, salt, additives)
- Consider fusion partners that enhance stability
Poor solubility- Hydrophobic transmembrane domains
- Native insolubility
- Delete or modify transmembrane domains
- Express only soluble domains
- Use detergents or chaotropic agents during purification
- Employ refolding protocols with gradually decreasing denaturant concentrations
Improper disulfide bond formation- Reducing cytoplasmic environment- Use specialized E. coli strains with oxidizing cytoplasm (e.g., SHuffle)
- Direct protein to periplasm using appropriate signal sequences
- Consider in vitro redox shuffling during refolding
Protein misfolding- Lack of post-translational modifications
- Absence of chaperones
- Implement step-wise dialysis refolding protocols
- Add molecular chaperones during refolding
- Use additives that promote folding (e.g., L-arginine, glycerol)
- Consider alternative expression systems for critical applications

These technical solutions have been successfully implemented to achieve functional recombinant PEDV M protein expression in prokaryotic systems, as evidenced by its successful use in generating specific antibodies and developing diagnostic assays .

How can researchers address cross-reactivity issues in PEDV M protein-based diagnostic assays?

Cross-reactivity is a critical challenge in developing specific PEDV M protein-based diagnostic assays. Researchers can employ several methodological approaches to enhance specificity:

  • Epitope selection and engineering:

    • Conduct comprehensive sequence alignment analyses of M proteins from PEDV and related coronaviruses

    • Identify unique regions in PEDV M protein with minimal homology to other viruses

    • Design recombinant proteins or synthetic peptides based on these unique epitopes

    • Validate specificity using well-characterized virus panels

  • Antibody purification and absorption techniques:

    • Implement affinity chromatography to purify antibodies using recombinant PEDV M protein

    • Perform cross-absorption against related viral antigens to remove cross-reactive antibodies

    • Use epitope-specific antibody selection to enhance specificity

    • Validate purified antibodies against a panel of related coronaviruses and other porcine viruses

  • Optimization of assay conditions:

    • Systematically evaluate different blocking agents (BSA, casein, commercial blockers) to reduce non-specific binding

    • Optimize antibody concentrations, incubation times, and washing conditions

    • Test various detection systems to maximize signal-to-noise ratio

    • Implement stringent cutoff values based on statistical analysis of well-characterized samples

  • Verification through parallel testing:

    • Conduct parallel testing with gold standard methods (virus neutralization, RT-PCR)

    • Calculate sensitivity, specificity, and predictive values

    • Perform ROC curve analysis to determine optimal cutoff values

    • Assess the diagnostic performance using field samples from different geographical regions

  • Multiplex approach development:

    • Design assays that simultaneously detect multiple PEDV antigens (M protein plus N or S proteins)

    • Implement confirmatory testing algorithms requiring positivity to multiple antigenic targets

    • Develop competitive ELISAs using monoclonal antibodies against specific epitopes

    • Create blocking ELISAs that can distinguish between closely related viruses

Research has demonstrated that properly developed M protein-based assays can achieve high specificity with no cross-reactivity to other porcine coronaviruses (TGEV) or other common swine viruses, as evidenced by experimental validation using immunofluorescence and ELISA methodologies .

What emerging research areas could expand our understanding of PEDV M protein functions?

Several promising research directions could significantly advance our understanding of PEDV M protein functions:

  • Structural biology approaches:

    • High-resolution structural determination of PEDV M protein using cryo-electron microscopy

    • Mapping of functional domains through structure-function correlation studies

    • Identification of critical residues for protein-protein interactions through mutagenesis guided by structural data

    • Molecular dynamics simulations to understand conformational changes during viral assembly

  • Systems biology integration:

    • Comprehensive interactome mapping of M protein with host cellular proteins

    • Proteomic profiling of M protein post-translational modifications and their functional significance

    • Network analysis of M protein-mediated signaling pathway alterations

    • Multi-omics approaches to understand global cellular responses to M protein expression

  • Advanced immune evasion mechanisms:

    • Detailed mapping of M protein interactions with additional innate immune components beyond IRF7

    • Investigation of potential M protein roles in adaptive immunity modulation

    • Comparative analysis of immune evasion strategies across different coronavirus M proteins

    • Development of immune evasion-deficient M protein variants for attenuated vaccine candidates

  • Novel therapeutic targeting:

    • Design of small molecule inhibitors targeting M protein-IRF7 interactions

    • Development of peptide-based antagonists that restore innate immune signaling

    • Screening compound libraries for molecules that disrupt M protein functions

    • Exploration of RNA interference approaches targeting M protein expression

  • Evolutionary dynamics analysis:

    • Comprehensive phylogenetic analysis of M protein across PEDV isolates

    • Identification of selection pressures acting on different M protein domains

    • Tracking evolutionary changes in M protein following vaccination programs

    • Prediction of potential future evolutionary adaptations through mathematical modeling

These emerging research areas hold significant potential to reveal novel aspects of PEDV M protein biology, potentially leading to improved diagnostic, therapeutic, and preventive strategies for controlling PEDV infections.

How might advances in protein engineering be applied to enhance recombinant PEDV M protein utility?

Advanced protein engineering approaches offer exciting opportunities to enhance the utility of recombinant PEDV M protein for various applications:

  • Structural optimization for improved expression:

    • Rational design of stabilized M protein variants through disulfide engineering

    • Removal or modification of hydrophobic transmembrane domains while preserving antigenic properties

    • Introduction of solubility-enhancing mutations identified through computational prediction

    • Development of chimeric proteins combining optimal expression with preserved epitopes

  • Immunogen enhancement:

    • Engineering multivalent constructs displaying multiple PEDV epitopes (M protein combined with S or N protein epitopes)

    • Incorporation of molecular adjuvants (e.g., flagellin, C3d) into M protein constructs

    • Design of nanoparticle-forming M protein variants for enhanced immunogenicity

    • Creation of glycan-modified M protein to modulate immune responses

  • Diagnostic reagent improvement:

    • Development of reporter-fused M protein constructs for direct detection systems

    • Engineering stabilized M protein variants with enhanced shelf-life for diagnostic kits

    • Creation of orientation-controlled immobilization strategies for improved assay sensitivity

    • Design of conformation-specific variants that mimic native viral epitopes

  • Therapeutic development platforms:

    • Engineering M protein decoys that can interfere with viral assembly

    • Development of non-immunosuppressive M protein variants that maintain structure but lack IFN antagonism

    • Creation of cell-penetrating M protein constructs for intracellular delivery

    • Design of M protein-based antiviral delivery systems

  • Biosensor and detection technology integration:

    • Fusion of M protein with fluorescent or luminescent reporters for direct virus detection

    • Engineering M protein variants compatible with surface plasmon resonance (SPR) for real-time interaction studies

    • Development of aptamer-recognizing M protein variants for simplified detection systems

    • Creation of self-assembling M protein structures for enhanced detection platforms

These protein engineering approaches represent a frontier in PEDV research, with the potential to transform our ability to detect, prevent, and control this economically significant pathogen through enhanced diagnostic tools and vaccine candidates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.