Recombinant Porcine epidemic diarrhea virus Non-structural protein 3 (3)

Shipped with Ice Packs
In Stock

Description

Domain Architecture

nsp3 is the largest transmembrane protein encoded by PEDV, containing:

DomainFunctionReference
Papain-like protease (PLpro)Cleavage of viral polyproteins pp1a/pp1ab; deubiquitination activity
ADP-ribose 1''-phosphatase (ADRP)Removal of ADP-ribose moieties; potential role in RNA capping
Transmembrane regionsAnchoring to host membranes; interaction with replicase complex

Key Features:

  • PLpro domains (PLP1 and PLP2): Critical for proteolytic processing of viral polyproteins, enabling the formation of mature nsps .

  • ADRP activity: Facilitates RNA capping and evasion of host innate immune sensors like RIG-I .

Role in Replication and Transcription

nsp3 is integral to the viral replicase-transcriptase complex (RTC), which orchestrates:

  1. Genomic RNA synthesis: Negative-strand RNA production for viral replication .

  2. Transcription of subgenomic RNAs: Template switching for structural protein synthesis .

  3. Polyprotein processing: Cleavage of pp1a/pp1ab into functional nsps (e.g., nsp1–nsp16) .

Proteolytic and Deubiquitinating Functions

ActivityMechanismImplication
PLpro-mediated cleavageHydrolysis of peptide bonds in pp1a/pp1abRelease of nsps for RTC assembly
DeubiquitinationRemoval of ubiquitin chains from proteinsSuppression of host immune responses

Studies Highlight:

  • nsp3’s PLpro domains are conserved across coronaviruses, with structural homology to SARS-CoV-2 PLpro .

  • Deubiquitination may counteract host ubiquitination-dependent immune pathways .

Immune Evasion Strategies

While nsp3’s direct role in immune evasion is less characterized compared to nsp1 or nsp5, its involvement in:

  • ADRP activity: Potential interference with host RNA sensors (e.g., RIG-I) .

  • RTC assembly: Indirectly shields viral RNA from detection by innate immune receptors .

Key Studies on nsp3

Study FocusFindingsReference
Structural analysisCrystallography reveals PLpro domain architecture
Functional assaysPLpro activity essential for viral replication
Recombination dynamicsnsp3 regions involved in PEDV strain diversification

Notable Observations:

  • Recombination Hotspots: nsp3-encoding regions (e.g., ORF1b) are prone to recombination, contributing to PEDV diversity .

  • Diagnostic Potential: Recombinant nsp3 could serve as a target for serological assays, though cross-reactivity with other coronaviruses (e.g., TGEV) remains a challenge .

Challenges and Future Directions

  • Structural Insights: Limited high-resolution data on nsp3’s transmembrane regions and interactions with host membranes .

  • Therapeutic Targeting: PLpro inhibitors (e.g., calpain inhibitors) show promise but require optimization for PEDV specificity .

  • Vaccine Development: nsp3’s conserved domains may inform subunit vaccine designs, though immune responses to nsps are weaker than structural proteins like S or N .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
3; Non-structural protein 3; ns3; Accessory protein 3a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Porcine epidemic diarrhea virus (strain CV777) (PEDV)
Target Names
3
Target Protein Sequence
MFLGLFQYTIDTVVKDVSKSVNLSLDAVQELELNVVPIRQASNVTGFLFTSVFVYFFALF KASSLRRNYIMLAARFAVVFLYCPLLYYCGALLDATIICCALIGRLCLVCFYSWRYKNAL FIIFNTTTLSFLNGKAAYYDGKSIVILEGGDHYITFGNSFVAFVSNIDLYLAIRGRQEAD LHLLRTVELLDGKKLYVFSQHQIVGITNAAFDSIQLDEYATISE
Uniprot No.

Target Background

Gene References Into Functions
  1. Based on the ORF3 gene, PEDV isolates from pigs in mid-eastern China can be classified into three genogroups. [PMID: 25673903](https://www.ncbi.nlm.nih.gov/pubmed/25673903)
  2. A structural model of the ORF3 protein has been proposed, suggesting a tetrameric assembly with four transmembrane domains. [PMID: 22245155](https://www.ncbi.nlm.nih.gov/pubmed/22245155)
Database Links

KEGG: vg:935183

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of PEDV Nsp3 and what domains are critical for its function?

PEDV Nsp3 is the largest nonstructural protein in the viral genome and comprises multiple structural domains that contribute to its diverse functions. The protein contains:

  • A highly acidic domain at the amino terminus (Ac)

  • A highly conserved ADP-ribose-1-phosphatase (ADRP) macrodomain

  • Papain-like protease (PLP) domains

The Ac domain is essential for virion assembly and plays a critical role in interaction with the viral nucleocapsid during early infection, while the ADRP provides activities necessary for synthesis of genomic and subgenomic RNAs . The PLP domain has been implicated in antagonizing host innate immune responses by inhibiting type I interferon production .

What are the standard protocols for cloning and expressing recombinant PEDV Nsp3?

Based on recent literature, the recommended procedure for cloning and expressing recombinant PEDV Nsp3 is:

  • Amplify the Nsp3 gene using PEDV cDNA as a template

  • Clone the gene into an expression vector such as pET-28a through restriction enzyme sites (commonly EcoRⅠ and XhoⅠ)

  • Transform the recombinant plasmid into Escherichia coli BL21 (DE3)

  • Induce protein expression with 0.8 mM IPTG (overnight at 37°C)

  • Harvest bacterial cells and lyse through sonication

  • Purify the protein from inclusion bodies using His-Sep Ni-NTA Agarose Resin

  • Elute with a gradient of imidazole concentrations

  • Assess quality through SDS-PAGE and Western blotting analyses

  • Determine protein concentration using a bovine serum albumin protein assay kit

This methodology has been validated for generating sufficient quantities of Nsp3 protein for immunological and structural studies.

How can researchers develop effective monoclonal antibodies against PEDV Nsp3?

Developing effective monoclonal antibodies (mAbs) against PEDV Nsp3 requires:

  • Immunization protocol: Mix purified Nsp3 recombinant proteins with ISA206 adjuvant (1:1 ratio) and immunize mice with 60 μg protein three times at 3-week intervals

  • Screening strategy: Perform indirect ELISA using purified Nsp3 protein (2 μg/mL) coated on microtiter plates

  • Cell fusion and selection: Select mice with highest antibody titers (>1:400,000) as spleen cell donors for hybridoma production

  • Subcloning: Perform 2-3 rounds of subcloning by limiting dilution to ensure monoclonality

  • Validation: Characterize mAbs by:

    • Assessing stability across multiple generations (>25)

    • Determining antibody subtype using identification kits

    • Confirming specificity through Western blotting and immunofluorescence assays

Recent studies produced mAbs (7G4, 5A3, and 2D7) that recognize distinct epitopes in Nsp3 with high specificity, demonstrating the effectiveness of this approach .

What are the identified B-cell epitopes in PEDV Nsp3 and how might they contribute to vaccine development?

Three novel linear B-cell epitopes have been identified in PEDV Nsp3 using monoclonal antibodies and truncated protein expression analysis:

EpitopeAmino Acid SequencemAbLocationConservation
131-TISQDLLDVE-407G4Surface-exposedHighly conserved
2141-LGIVDDPAMG-1505A3Partially exposedConserved
3282-FYDAAMAIDG-2912D7Partially buriedConserved

The epitope 31-TISQDLLDVE-40 is particularly promising for vaccine development as it:

  • Is completely exposed on the protein surface

  • Has a high antigenic index

  • Shows conservation across most PEDV genotypes

  • Maximizes possibilities for antigen-antibody interaction

These epitopes could serve as the basis for epitope-based vaccines targeting key areas of Nsp3, potentially resulting in more effective and targeted immune responses against PEDV infection.

What methodologies are most effective for studying Nsp3's role in viral replication complexes?

To investigate Nsp3's role in viral replication complexes (RTC), researchers should employ a multi-technique approach:

  • Co-immunoprecipitation (Co-IP): To identify interactions between Nsp3 and other viral/host proteins involved in RTC formation

  • Confocal microscopy: To visualize the co-localization of Nsp3 with double-membrane vesicles (DMVs) and other replication components

  • Transmission electron microscopy (TEM): To directly observe DMV formation in cells expressing Nsp3

  • CRISPR-Cas9 mutagenesis: To generate Nsp3 domain mutants for functional analysis

  • Replicon systems: To assess the impact of Nsp3 mutations on viral RNA synthesis without producing infectious virions

Studies indicate that Nsp3, along with Nsp4 and Nsp6, triggers the synthesis of DMVs that serve as platforms for viral RNA synthesis . The formation of these structures is crucial for establishing additional RTCs and increasing viral RNA production.

How does Nsp3 contribute to PEDV's ability to antagonize host innate immune responses?

PEDV Nsp3 antagonizes host innate immunity through several mechanisms:

  • Interferon (IFN) antagonism:

    • The PLP domain functions as a viral IFN antagonist by cleaving ubiquitin chains of RIG-I and STING

    • This effectively inhibits the activation of type I IFN signaling transduction

  • Deubiquitinating (DUB) activity:

    • Removes ubiquitin modifications from proteins involved in antiviral innate immune pathways

    • Blocks or delays host innate immune responses in infected cells

  • NF-κB signaling inhibition:

    • May suppress ubiquitination of IκBα

    • Restricts phosphorylation and nuclear translocation of p65

  • IRF3 signaling interference:

    • May compete with IRF3 for TBK1 binding

    • Inhibits IRF3 activation and production of type I IFNs

Methodologically, these mechanisms can be studied using reporter assays, co-immunoprecipitation, and protein degradation analyses in relevant cell culture systems.

What are the current approaches for analyzing recombination events involving the Nsp3 region of PEDV?

Recombination in the Nsp3 region of PEDV can be analyzed using:

  • Whole genome sequencing: Generate complete genomic sequences using next-generation sequencing platforms

  • Multiple sequence alignment: Employ tools like MAFFT v.7.402 to align sequences for comparative analysis

  • Recombination detection software:

    • Recombination Detection Program (RDP4) using multiple methods:

      • RDP, MaxChi, GENECONV, BootScan, Chimaera, SiScan, and 3SEQ

    • SimPlot software with parameters:

      • Window size: 500 base pairs

      • Step size: 100 nucleotides

      • Bootstrap replicates: 1,000

      • ML distance model

  • Phylogenetic analysis:

    • Construct maximum-likelihood phylogenetic trees using IQ-TREE

    • Calculate bootstrap values from 1,000 replicates for each node

    • Visualize using ChiPlot or similar tools

Recent studies have identified recombination events in seven main areas of the PEDV genome, including nsp3, which significantly contributes to viral diversity and evolution . For example, the HUA-14PED96/2014 strain contains a 72-nucleotide deletion in ORF1a, corresponding to a 24-amino acid deletion in the nsp3 protein .

How can researchers effectively differentiate between the impacts of Nsp3 mutations versus other viral proteins in PEDV pathogenesis?

To differentiate the impacts of Nsp3 mutations from other viral proteins:

  • Reverse genetics systems:

    • Generate isogenic recombinant PEDV viruses differing only in Nsp3

    • Evaluate phenotypic differences in replication, pathogenesis, and host responses

  • Domain-specific mutagenesis:

    • Create targeted mutations in specific Nsp3 domains (Ac, ADRP, PLP)

    • Assess domain-specific functions independently

  • Complementation assays:

    • Express wild-type Nsp3 in trans to rescue mutant phenotypes

    • Confirm specific attribution of observed defects to Nsp3 mutations

  • Animal infection models:

    • Compare pathogenicity of Nsp3 mutants in piglets

    • Monitor clinical parameters including:

      • Diarrhea severity

      • Weight loss (gain/loss percentage)

      • Viral shedding (quantified by RT-qPCR)

      • Survival rates

      • Serum cytokine profiles (particularly IFN-λ)

  • Transcriptomic analysis:

    • Compare host response patterns to wild-type versus Nsp3 mutant viruses

    • Identify differentially expressed genes and pathways

Recent studies have shown that some highly virulent PEDV strains contain deletions in the nsp3 protein region, suggesting that Nsp3 modifications may contribute significantly to pathogenicity differences between strains .

What are the potential applications of Nsp3-targeting single-chain variable fragments (scFvs) for PEDV treatment and prevention?

While current research has primarily focused on scFvs targeting the PEDV N protein, the application of Nsp3-targeting scFvs represents a promising research direction:

  • Development methodology:

    • Clone Nsp3-specific scFvs into adenovirus vectors for effective expression

    • Validate expression both in vitro and in vivo

    • Assess co-localization with viral proteins in infected tissues

  • Potential therapeutic mechanisms:

    • Disruption of Nsp3's role in replication complex formation

    • Neutralization of Nsp3's immune antagonist functions

    • Prevention of Nsp3-mediated DMV formation

  • Administration routes:

    • Oral delivery using recombinant adenovirus vectors

    • Target expression in intestinal epithelial cells

  • Efficacy assessment:

    • Monitor clinical parameters in challenge studies (diarrhea severity, weight gain/loss)

    • Measure viral shedding via RT-qPCR

    • Analyze serum cytokine expression, particularly IFN-λ

Building on successful models that demonstrated effective protection against PEDV using N-targeting scFvs , Nsp3-targeting approaches could provide complementary strategies by interfering with different aspects of the viral life cycle.

How might structural analysis of PEDV Nsp3 inform drug discovery efforts targeting coronavirus replication?

Structural analysis of PEDV Nsp3 has significant implications for anti-coronavirus drug discovery:

  • Structural determination approaches:

    • X-ray crystallography of purified recombinant Nsp3 domains

    • Cryo-electron microscopy to visualize Nsp3 within replication complexes

    • NMR spectroscopy for dynamic structure-function relationships

  • Target identification strategies:

    • Focus on highly conserved functional domains across coronaviruses

    • Prioritize structures involved in:

      • ADP-ribose-1-phosphatase activity

      • Papain-like protease function

      • Protein-protein interactions essential for replication complex formation

  • Computer-aided drug design:

    • In silico screening against identified Nsp3 pockets

    • Structure-based optimization of lead compounds

    • Molecular dynamics simulations to account for protein flexibility

  • Cross-coronavirus applicability:

    • Compare Nsp3 structures between PEDV, SARS-CoV-2, and other coronaviruses

    • Identify conserved druggable sites for broad-spectrum antivirals

The conserved nature of Nsp3 across coronaviruses makes it an attractive target for broad-spectrum inhibitors. Research has shown that Nsp3 is highly conserved at the epitope level across different PEDV genotypes , suggesting that Nsp3-targeting drugs might also have cross-protective potential against multiple PEDV variants and possibly other coronaviruses.

What are the optimal systems for expressing and purifying functional domains of PEDV Nsp3 for structural studies?

Expressing and purifying functional PEDV Nsp3 domains presents several challenges requiring optimized approaches:

  • Expression systems comparison:

SystemAdvantagesLimitationsBest For
E. coliHigh yield, cost-effectiveOften forms inclusion bodiesDomains without PTMs
BaculovirusBetter folding, PTMsModerate yield, more complexMulti-domain fragments
Mammalian cellsNative-like PTMs, foldingLower yield, expensiveFull-length Nsp3
  • Solubility enhancement strategies:

    • Fusion tags: MBP, SUMO, or GST tags improve solubility

    • Domain isolation: Express individual domains rather than full-length protein

    • Co-expression with chaperones: GroEL/GroES system can improve folding

  • Purification protocol optimization:

    • For inclusion body purification:

      • Denature with 8M urea

      • Purify via His-tag affinity chromatography

      • Refold through gradual dialysis

    • For soluble protein:

      • Native purification using affinity chromatography

      • Ion exchange and size exclusion chromatography for higher purity

  • Quality assessment methods:

    • Circular dichroism to verify secondary structure

    • Thermal shift assays to assess stability

    • Functional assays specific to each domain (e.g., protease activity for PLP domain)

The choice of system should be tailored to the specific Nsp3 domain under investigation and the intended downstream applications.

What are the challenges in developing animal models to specifically study Nsp3 functions in PEDV pathogenesis?

Developing animal models to study Nsp3 functions specifically presents several methodological challenges:

  • Transgenic approaches limitations:

    • CRISPR/Cas9 editing of swine embryos is technically challenging

    • Generating domain-specific Nsp3 mutants requires precise genetic modifications

    • Phenotypic verification is complicated by embryonic lethality of some mutations

  • Ex vivo systems development:

    • Porcine intestinal enteroid cultures better represent the natural host environment

    • Optimization required for:

      • Growth media composition

      • Differentiation protocols

      • Infection conditions

      • Readout systems for Nsp3 function

  • Conditional expression systems:

    • Inducible expression of wild-type or mutant Nsp3 in target tissues

    • Tetracycline-responsive or Cre/loxP systems can provide temporal control

    • Delivery methods for genetic constructs remain challenging in swine models

  • Neonatal piglet models considerations:

    • Standardization of age, weight, and genetic background

    • Controlling for maternal antibody interference

    • Humane endpoints and ethical considerations

    • Housing requirements for biosafety containment

  • Readout systems optimization:

    • Intestinal tissue sampling protocols at multiple timepoints

    • Multiparameter analysis including:

      • Histopathology scoring systems

      • Viral load quantification by compartment

      • Immune response profiling

      • Transcriptomic and proteomic analyses

Researchers should consider using complementary approaches, combining in vitro mechanistic studies with targeted in vivo experiments to overcome these challenges.

How can systems biology approaches enhance our understanding of PEDV Nsp3's role in viral pathogenesis?

Systems biology approaches offer powerful tools for understanding PEDV Nsp3's complex role:

  • Interactome mapping:

    • Proximity labeling techniques (BioID, APEX) to identify Nsp3 protein interaction networks

    • Comparison between wild-type and mutant Nsp3 interactomes

    • Validation through co-immunoprecipitation and functional assays

  • Multi-omics integration:

    • Transcriptomics to identify genes differentially expressed in response to Nsp3

    • Proteomics to detect changes in protein abundance and post-translational modifications

    • Metabolomics to identify metabolic pathways affected by Nsp3 expression

    • Computational integration to build comprehensive models of Nsp3 function

  • Single-cell analysis:

    • scRNA-seq to characterize cell-specific responses to PEDV infection

    • Spatial transcriptomics to map infection progression in intestinal tissue

    • Correlation of cellular responses with Nsp3 expression levels

  • Network perturbation analysis:

    • CRISPR screens to identify host factors essential for Nsp3 function

    • Small molecule inhibitor panels to disrupt specific pathways

    • Mathematical modeling to predict intervention points

These approaches can reveal how Nsp3 functions within the broader context of virus-host interactions, potentially identifying novel therapeutic targets and intervention strategies that might not be apparent from reductionist approaches.

What comparative insights can be gained by studying Nsp3 across different coronaviruses, and how might this inform pandemic preparedness?

Comparative analysis of Nsp3 across coronaviruses provides valuable insights for pandemic preparedness:

  • Evolutionary conservation analysis:

    • Compare Nsp3 sequences and structures across:

      • Swine coronaviruses (PEDV, PDCoV, TGEV)

      • Human coronaviruses (SARS-CoV, MERS-CoV, SARS-CoV-2)

      • Bat coronaviruses (potential reservoirs)

    • Identify highly conserved domains as potential broad-spectrum targets

  • Functional domain comparison:

    • Map domain architecture differences across coronavirus families

    • Correlate structural variations with pathogenicity differences

    • Identify virus-specific adaptations in Nsp3 function

  • Cross-species inhibitor development:

    • Design antivirals targeting conserved Nsp3 domains

    • Test efficacy against multiple coronavirus family members

    • Develop libraries of ready-to-test compounds for emerging coronaviruses

  • Predictive modeling applications:

    • Use machine learning to predict functional consequences of Nsp3 mutations

    • Monitor emerging coronavirus sequences for high-risk Nsp3 variants

    • Develop early warning systems based on Nsp3 sequence changes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.