Recombinant Porcine hemagglutinating encephalomyelitis virus Hemagglutinin-esterase (HE)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Porcine Hemagglutinating Encephalomyelitis Virus Hemagglutinin-esterase (HE)

Porcine hemagglutinating encephalomyelitis virus (PHEV) is a betacoronavirus that leads to vomiting and wasting disease, as well as encephalomyelitis, in young pigs . The hemagglutinin-esterase (HE) protein is a key component of this virus. HE is a spike glycoprotein expressed by certain strains of viruses, including PHEV and some murine hepatitis viruses (MHV) . Recombinant forms of PHEV HE are produced using genetic engineering techniques, which allows researchers to study the protein in isolation, develop vaccines, and create diagnostic tools .

Structure and Function of Hemagglutinin-esterase (HE)

HE protein facilitates viral entry into host cells and promotes the spread of the virus within the host . It mediates receptor binding and possesses esterase activity, which aids in the release of virions from infected cells . The HE protein's functions include:

  • Receptor Binding: HE binds to specific receptors on the host cell surface, initiating the process of viral attachment and entry .

  • Esterase Activity: The esterase domain of HE helps in removing sialic acid residues from the cell surface, preventing the virus from re-attaching to already infected cells and facilitating its spread .

  • Enhancing Neurovirulence: Research indicates that HE can enhance the neurovirulence of certain viruses, promoting viral dissemination within the central nervous system .

Role in Pathogenesis

PHEV primarily infects the nasal mucosa and tonsillar epithelium, spreading through the peripheral nervous system to the brainstem and spinal cord . The presence of HE contributes to the virus's ability to cause encephalomyelitis . Specifically, the HE protein can increase the efficiency of infection and promote viral dissemination in certain tissues .

Research Findings

  • RT-PCR Detection: Reverse transcription-polymerase chain reaction (RT-PCR) assays targeting the HE gene are used to detect PHEV in tissue samples . Primers are designed based on the conserved segments of the viral genome and validated using databases like GenBank .

  • In Vivo Infection Studies: Studies on cesarean-derived, colostrum-deprived (CDCD) neonatal pigs have shown that PHEV infection leads to mild respiratory, enteric, and neurological signs . The virus can be detected in nasal secretions and feces, with viral RNA present in various tissues, excluding the liver .

  • Recombinant Interferon Studies: Recombinant porcine interferon alpha (rPoIFNα) has been explored as an adjuvant to enhance the immunological response to vaccines against viruses like porcine transmissible gastroenteritis virus (TGEV) .

Applications of Recombinant HE

  1. Vaccine Development: Recombinant HE can be used to develop vaccines against PHEV.

  2. Diagnostic Assays: The HE gene serves as a target for RT-PCR-based diagnostic assays to detect PHEV infections in swine .

  3. Research Tool: Recombinant HE is used to study the pathogenesis of PHEV and to understand the role of HE in viral entry, spread, and neurovirulence .

Tables of Data

Table 1: RT-PCR Primers for Detection of PHEV

GenePrimer Sequence (Forward)Primer Sequence (Reverse)
HE$$insert sequence here]$$insert sequence here]

Note: Actual primer sequences should be obtained from relevant publications and databases like GenBank.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HE; Hemagglutinin-esterase; HE protein; E3 glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-424
Protein Length
Full Length of Mature Protein
Species
Porcine hemagglutinating encephalomyelitis virus (strain 67N) (HEV-67N)
Target Names
HE
Target Protein Sequence
FENPPTNVVSHFNDDWFLFGDSRSDCNHVVNTNPRNYSYMDLNPALCDSGKISSKAGNSI FRSFHFTDFYNYTGEGQQIIFYEGVNFTPYHAFKCTSAGNNDIWMQNKGLFYTQVYKKMA VYRSLTLVNVPYVYNGSAQPTAFCKSGSLILNNPAYIAREANVGDYYYKSEADFSLSGCD EYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDFNCHYLVLPSGN YLAISNELLLTVPTKAICLNKRKVFTPVQVVDSRWNNARQSDNMTAVACQLPYCYFRNST SNYVGIHDVNHGDAGFTSILSGLLYDSPCFSQQGVFRYDNVSTVWPLFPFGNCPTAASII SSDLPICVYDPLPIILLGILLGVAVIVIVVLLLYFMVDNGIRQHYA
Uniprot No.

Target Background

Function

Hemagglutinin-esterase (HE) is a structural protein forming short surface spikes on the porcine hemagglutinating encephalomyelitis virus. It exhibits receptor-binding and receptor-destroying activities, mediating the de-O-acetylation of N-acetyl-4-O-acetylneuraminic acid, a crucial receptor determinant for erythrocyte and susceptible cell recognition. This receptor-destroying activity is essential for viral release, preventing self-aggregation and facilitating efficient cell-to-cell spread of progeny virions. HE may function as a secondary viral attachment protein, complementing the primary spike protein in initiating infection. It may also serve as an immunological target for both humoral and cellular immune responses.

Protein Families
Influenza type C/coronaviruses hemagglutinin-esterase family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.

Q&A

What is PHEV and why is its hemagglutinin-esterase protein significant for research?

Porcine hemagglutinating encephalomyelitis virus (PHEV) is a betacoronavirus that causes vomiting and wasting disease and/or encephalomyelitis in suckling pigs. PHEV primarily affects the central nervous system in infected animals, causing neurological symptoms alongside vomiting, diarrhea, and wasting .

The hemagglutinin-esterase (HE) protein is one of the major structural proteins in PHEV that plays a critical role in viral attachment, entry, and release. As a surface glycoprotein, HE mediates binding to receptors on host cells and possesses receptor-destroying enzyme activity, making it crucial for understanding viral pathogenesis and developing potential countermeasures. The HE gene is also commonly used as a target for RT-PCR detection methods in diagnostic testing for PHEV .

What animal models are most appropriate for studying PHEV HE function?

Based on current research, cesarean-derived, colostrum-deprived (CDCD) neonatal pigs represent an optimal animal model for studying PHEV infection dynamics and HE protein function. These models effectively demonstrate how PHEV causes clinical manifestations while allowing for detailed observation of virus shedding patterns in nasal secretions (1-10 days post-inoculation) and feces (2-7 days post-inoculation) .

For researchers with limited access to pig models, laboratory mice can serve as alternative subjects, as they also develop central nervous system dysfunction when inoculated with PHEV, exhibiting symptoms such as depression, arched waists, and abnormal claw movements .

For in vitro studies, the air-liquid interface CDCD-derived porcine respiratory cells culture (ALI-PRECs) system effectively replicates the epithelial lining of the tracheobronchial region, providing an excellent platform for studying HE protein interactions with respiratory epithelium .

What detection methods are most effective for identifying PHEV HE in experimental samples?

Real-time reverse transcription-polymerase chain reaction (RT-PCR) targeting the HE gene represents the gold standard for laboratory detection of PHEV. When designing primers, researchers should focus on the most conserved segments of the HE gene sequence to ensure reliable amplification .

Methodologically, a comprehensive testing approach should include:

  • RT-PCR detection targeting the HE gene as the primary identification method

  • Electron microscopy to visualize coronavirus-like particles in tissue homogenates (particularly effective in brain tissue samples)

  • Histopathologic examination for characteristic non-suppurative encephalitis features

  • Immunohistochemistry with PHEV-specific antibodies to confirm positive labeling of neurons in cortices

For differentiation from other porcine viruses with similar clinical presentations, samples should concurrently be tested for porcine epidemic diarrhea virus (PEDV), porcine transmissible gastroenteritis virus (TGEV), porcine deltacoronavirus (PDCoV), and pseudorabies virus (PRV) .

What are the optimal expression systems for producing recombinant PHEV HE protein for structural and functional studies?

For recombinant PHEV HE protein expression, researchers should consider several expression systems depending on research objectives:

  • Bacterial expression systems (E. coli): While cost-effective, these systems often produce inclusion bodies requiring refolding. They're suitable for generating antibodies against linear epitopes but may not preserve conformational epitopes due to lack of post-translational modifications.

  • Insect cell expression systems (Baculovirus): These provide superior folding and post-translational modifications compared to bacterial systems, making them appropriate for functional studies and structural analyses requiring properly folded HE protein.

  • Mammalian cell expression systems: These offer the closest approximation to native viral protein with proper glycosylation patterns, though at higher cost and lower yield. HEK293T or CHO cells represent optimal choices for producing HE protein intended for receptor binding assays or vaccine development.

Purification protocols should include immobilized metal affinity chromatography (IMAC) for His-tagged proteins, followed by size exclusion chromatography to obtain highly purified protein suitable for crystallography or functional assays.

How do mutations in the HE gene affect PHEV pathogenicity and tropism?

Research indicates significant variations in pathogenicity among different PHEV strains, suggesting that mutations in structural genes, including HE, influence viral behavior in vivo. Phylogenetic analysis of PHEV strains reveals 95%-99.2% nucleotide identity between different isolates, with clustering patterns suggesting evolutionary divergence that may correlate with pathogenicity differences .

To investigate the relationship between HE mutations and pathogenicity, researchers should:

  • Perform comparative sequence analysis of HE genes from multiple PHEV isolates exhibiting different virulence profiles

  • Generate recombinant viruses with specific mutations in the HE gene using reverse genetics systems

  • Evaluate altered receptor binding properties using glycan arrays and cell binding assays

  • Assess changes in neurovirulence through in vivo challenge studies in appropriate animal models

  • Quantify differences in viral distribution in neural tissues using immunohistochemistry and viral load assays

The strong neurotropism of PHEV suggests that specific domains within the HE protein may facilitate central nervous system invasion and replication, making structure-function analyses particularly valuable.

What is the potential for cross-reactivity between antibodies against PHEV HE and other coronavirus HE proteins?

Due to evolutionary relationships among betacoronaviruses, researchers must carefully consider potential cross-reactivity when developing immunological assays for PHEV HE. The HE proteins of various coronaviruses share conserved domains that may generate cross-reactive antibodies, potentially confounding experimental results.

When developing antibodies against recombinant PHEV HE:

  • Target unique epitopes specific to PHEV HE through careful epitope mapping

  • Perform extensive validation using samples from animals exposed to related betacoronaviruses

  • Implement competitive binding assays to assess specificity

  • Consider monoclonal antibody development for highest specificity

  • Validate all antibodies using western blot, ELISA, and immunohistochemistry with appropriate controls

What is the role of PHEV HE in neuroinvasion and neuropathogenesis?

PHEV demonstrates pronounced neurotropism, with histopathological examinations revealing non-suppurative encephalitis and neuronal degeneration, necrosis, and neuronophagia in infected animals . The mechanisms by which PHEV, and specifically its HE protein, contributes to neuroinvasion remain incompletely characterized.

Research methodologies to investigate HE's role in neuropathogenesis should include:

  • Ex vivo neural cell culture models: Develop primary neuronal or glial cultures from porcine brain tissue to study direct effects of recombinant HE protein on neural cells

  • Blood-brain barrier models: Employ transwell systems with brain microvascular endothelial cells to assess whether HE facilitates viral passage across the BBB

  • Retrograde axonal transport studies: Use fluorescently labeled recombinant HE to track potential neural spread via peripheral nerve routes

  • Comparative binding assays: Evaluate binding affinity of wild-type and mutant HE proteins to neural tissue sections to identify critical binding domains

  • Transcriptomic analysis: Compare neural gene expression patterns following exposure to active versus inactive HE protein

What are the optimal sampling procedures for detecting PHEV HE in different tissues?

Effective tissue sampling is critical for PHEV detection and research. Based on experimental infections, researchers should implement the following protocols:

  • Respiratory tract sampling: Collect nasal swabs daily from 1-10 days post-infection, as virus shedding is consistently detected during this period

  • Fecal sampling: Obtain fecal samples between 2-7 days post-infection

  • Neural tissue collection: Brain tissue, particularly cerebral cortex, should be prioritized due to PHEV's neurotropism

  • Sample processing: For RNA extraction, tissues should be homogenized in RNase-free conditions using mechanical disruption

  • Storage conditions: Samples should be maintained at -80°C for RNA preservation; alternatively, RNAlater can be used when immediate freezing isn't possible

When designing studies specifically focused on HE expression, researchers should note that PHEV demonstrates tissue-specific detection patterns, with viral RNA detected across multiple tissue types but with varying detection rates and viral loads .

How can researchers effectively differentiate between wild-type and recombinant PHEV HE in experimental settings?

To distinguish between wild-type and recombinant PHEV HE:

  • Molecular tagging: Engineer recombinant HE with epitope tags (His, FLAG, etc.) that can be detected using tag-specific antibodies

  • Sequence verification: Design primers that specifically amplify unique junctions created during the recombinant construction process

  • Restriction enzyme analysis: Introduce unique restriction sites in the recombinant construct that allow differentiation through digestion patterns

  • Western blot analysis: Use antibodies that detect specific modifications introduced in the recombinant protein

  • Mass spectrometry: Perform peptide mass fingerprinting to identify sequence differences between wild-type and recombinant proteins

What cell culture systems best support functional studies of recombinant PHEV HE?

The most effective cell culture system for studying PHEV HE function is the air-liquid interface CDCD-derived porcine respiratory cells culture (ALI-PRECs). This system accurately replicates the epithelial lining of the tracheobronchial region of the porcine respiratory tract, which has been identified as a primary site of PHEV infection .

When utilizing this system:

  • Maintain ALI-PRECs cultures according to established protocols to ensure the development of well-differentiated ciliated columnar epithelia

  • Monitor cellular integrity through measurement of transepithelial electrical resistance (TEER)

  • Examine cytopathic effects, which typically manifest as cytoplasmic swelling, vacuolation, cell rounding, clustering, shrinkage, and detachment

  • Collect platewell subnatants at regular intervals (12, 24, 36, and 48 hours post-infection) for quantification of viral replication by RT-qPCR

  • Perform immunofluorescence staining to visualize HE protein localization within infected cells

For studies specifically focused on neurotropism, consider employing porcine brain microvascular endothelial cells or primary neuronal cultures as complementary models.

How should researchers interpret apparent contradictions in PHEV HE detection across different sample types?

When encountering discrepancies in PHEV HE detection across sample types, researchers should consider several methodological and biological factors:

  • Sampling timing: Virus shedding patterns vary by sample type, with nasal secretions positive from 1-10 days post-inoculation and fecal samples from 2-7 days post-inoculation

  • Detection sensitivity: Different sample matrices may contain varying levels of PCR inhibitors that affect detection limits

  • Viral tropism: PHEV demonstrates tissue-specific affinity, with neural tissues often containing higher viral loads

  • RNA degradation: Sample handling and storage conditions significantly impact RNA integrity and detection success

  • Primer design: The specific region of the HE gene targeted by primers affects detection sensitivity due to sequence variability between strains

Recommended approach for resolving contradictions:

  • Employ multiple detection methods (RT-PCR, immunohistochemistry, virus isolation)

  • Include internal amplification controls to identify PCR inhibition

  • Sequence positive samples to confirm authenticity

  • Consider digital droplet PCR for absolute quantification across sample types

  • Report cycle threshold (Ct) values alongside binary positive/negative results

What statistical approaches are most appropriate for analyzing PHEV HE expression data?

For robust statistical analysis of PHEV HE expression data, researchers should consider:

  • Normalization strategies:

    • For RT-qPCR data, normalize HE expression to multiple validated reference genes (minimum of 3) selected for stability in the specific tissue type

    • For protein quantification, normalize to total protein or appropriate housekeeping proteins

  • Statistical tests:

    • For comparing expression levels between groups, use parametric tests (t-test, ANOVA) only after confirming normal distribution

    • For non-normally distributed data, apply non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis)

    • For time-course studies, employ repeated measures ANOVA or mixed-effects models

  • Sample size calculations:

    • Perform power analysis prior to experimental design, considering biological variability in the animal model

    • For pig studies, account for potential clustering effects within litters

  • Multiple testing correction:

    • Apply appropriate corrections (Bonferroni, Benjamini-Hochberg) when performing multiple comparisons

    • Report both raw and adjusted p-values for transparency

  • Data visualization:

    • Present time-course data as line graphs with error bars

    • For comparing groups, use box plots to display distribution characteristics

    • Include individual data points to reveal potential outliers

What are the potential applications of recombinant PHEV HE in vaccine development?

Recombinant PHEV HE protein holds significant promise as a subunit vaccine candidate against porcine hemagglutinating encephalomyelitis. Researchers exploring this avenue should consider:

  • Antigen design strategies:

    • Full-length versus truncated HE constructs

    • Fusion constructs with immunostimulatory molecules

    • Multimeric presentations to enhance immunogenicity

    • Glycoengineering to preserve critical epitopes

  • Delivery platforms:

    • Protein-adjuvant formulations

    • Viral vector-based delivery (adenovirus, MVA)

    • mRNA-based approaches

    • DNA vaccines

  • Efficacy assessment parameters:

    • Neutralizing antibody titers against multiple PHEV strains

    • T-cell responses via ELISpot and intracellular cytokine staining

    • Protection metrics in challenge studies (clinical signs, viral shedding)

    • Duration of immunity studies (minimum 6-month follow-up)

  • Safety considerations:

    • Potential for antibody-dependent enhancement

    • Risk of autoimmune reactions due to molecular mimicry

    • Local and systemic reactogenicity

    • Special considerations for pregnant sows

How might structural studies of PHEV HE inform coronavirus evolution and cross-species transmission research?

Structural characterization of PHEV HE can provide valuable insights into coronavirus evolution and host range determinants. Research approaches should include:

  • Comparative structural analysis:

    • Crystal or cryo-EM structures of PHEV HE compared with HE proteins from other betacoronaviruses

    • Mapping of conserved versus variable regions

    • Identification of receptor-binding domains and their evolutionary constraints

  • Structure-guided mutagenesis:

    • Targeted mutations based on structural insights to assess species barrier determinants

    • Creation of chimeric HE proteins with domains from different coronavirus species

    • Evaluation of altered receptor preferences resulting from specific mutations

  • Receptor interaction studies:

    • Glycan array screening to determine specific receptor preferences

    • Surface plasmon resonance to quantify binding kinetics

    • Structure-based prediction of potential receptor adaptations enabling cross-species jumps

  • Evolutionary analyses:

    • Calculation of selection pressures on different HE domains

    • Identification of positively selected sites potentially involved in host adaptation

    • Reconstruction of ancestral HE sequences to trace evolutionary trajectories

  • Cross-reactivity assessment:

    • Antibody binding studies using sera from animals infected with different coronaviruses

    • Epitope mapping to identify conserved neutralization targets

    • Analysis of potential cross-protection between coronavirus species

What are common pitfalls in recombinant PHEV HE production and how can they be addressed?

Researchers frequently encounter several challenges when producing recombinant PHEV HE protein:

  • Low expression yields:

    • Optimize codon usage for expression system

    • Test multiple signal peptides for secretion efficiency

    • Evaluate different promoter strengths

    • Consider fusion partners that enhance solubility (SUMO, MBP, TRX)

    • Optimize induction conditions (temperature, inducer concentration, duration)

  • Protein misfolding and aggregation:

    • Reduce expression temperature (16-18°C)

    • Co-express with molecular chaperones

    • Include stabilizing additives (glycerol, arginine, low concentrations of detergents)

    • Consider periplasmic expression for disulfide bond formation in bacterial systems

    • Test refolding from inclusion bodies if necessary

  • Proteolytic degradation:

    • Add protease inhibitors during purification

    • Remove flexible linkers susceptible to proteolysis

    • Identify and mutate protease recognition sites

    • Optimize buffer conditions (pH, salt concentration)

    • Consider fusion constructs that mask protease recognition sites

  • Loss of functional activity:

    • Verify correct disulfide bond formation

    • Ensure proper glycosylation through glycoprotein analysis

    • Minimize freeze-thaw cycles

    • Optimize storage conditions (buffer composition, temperature)

    • Include stabilizing excipients for long-term storage

How can researchers overcome challenges in detecting PHEV HE antibodies in field samples?

Detection of antibodies against PHEV HE in field samples presents several challenges:

  • Cross-reactivity with other coronaviruses:

    • Develop blocking ELISAs using recombinant HE protein

    • Implement competitive formats with HE-specific monoclonal antibodies

    • Use western blot confirmation with purified recombinant protein

    • Consider peptide-based assays targeting PHEV-specific epitopes

    • Validate with true positive and negative samples from experimental infections

  • Low antibody titers:

    • Employ signal amplification strategies (biotin-streptavidin systems)

    • Optimize sample dilution protocols

    • Consider concentration methods for serum samples

    • Implement more sensitive detection systems (chemiluminescence)

    • Extend incubation times to improve sensitivity

  • Sample quality issues:

    • Establish standardized collection and storage protocols

    • Include internal controls to assess sample integrity

    • Develop methods for working with suboptimal samples

    • Consider multiple sample types (serum, oral fluids)

    • Implement quality control criteria for sample acceptance

  • Assay standardization:

    • Develop international reference standards

    • Implement calibration curves using defined antibody preparations

    • Establish uniform cutoff determination methods

    • Conduct regular inter-laboratory comparison studies

    • Document assay validation according to OIE guidelines

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.