Recombinant Porcine hemagglutinating encephalomyelitis virus Membrane protein (M)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
M; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Porcine hemagglutinating encephalomyelitis virus (strain 67N) (HEV-67N)
Target Names
M
Target Protein Sequence
MSSPTTPVPVISWTADEAIKFLKEWNFSLGIIVLFITIILQFGYTSRSMFVYVIKMVILW LMWPLTIILTIFNCVYALNNVYLGFSIVFTIVAIIMWVVYFVNSIRLFIRTGSWWSFNPE TNNLMCIDMKGRMYVRPIIEDYHTLTATIIRGHLYIQGIKLGTGYSLSDLPAYVTVAKVT HLCTYKRGFLDRIGDTSGFAVYVKSKVGNYRLPSTHKGSGMDTALLRNNI
Uniprot No.

Target Background

Function
A viral envelope component crucial for virus morphogenesis and assembly through interactions with other viral proteins.
Protein Families
Betacoronaviruses M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the role of the M protein in PHEV replication and assembly?

The M protein plays a critical role in PHEV viral assembly by linking the ribonucleoprotein complex with envelope glycoproteins. Based on studies of related viruses, the M protein likely regulates viral RNA synthesis through interactions with the nucleocapsid (N) protein . In measles virus, this interaction involves specific leucine residues at the carboxyl terminus of the N protein (L523 and L524) that are critical for binding with the M protein . The M protein has an intrinsic ability to associate with the plasma membrane, potentially retaining the ribonucleoprotein complex at this location, thereby halting viral RNA synthesis and promoting viral particle production .

Methodologically, researchers investigating PHEV M protein function should:

  • Express recombinant M protein in mammalian cell lines to observe localization patterns

  • Perform co-immunoprecipitation assays with other viral proteins

  • Use confocal microscopy to track protein co-localization in infected cells

  • Develop M protein mutants to identify functional domains essential for assembly

  • How does PHEV transmission occur and what tissues are primarily infected?

PHEV is transmitted via respiratory droplets and primarily infects epithelial cells of the upper respiratory tract . Research using air-liquid CDCD-derived porcine respiratory cells culture (ALI-PRECs) has demonstrated that tracheal epithelia serve as a primary site of infection . When infected, these cells develop marked cytopathic changes by 36 hours post-infection, including cytoplasmic swelling, vacuolation, cell rounding, and eventual detachment .

After initial respiratory infection, PHEV demonstrates neurotropism as the only known neurotropic coronavirus that affects swine . The virus does not produce viremia but can be detected in nasal secretions (1-10 days post-infection) and feces (2-7 days post-infection) .

  • What are the basic characteristics of PHEV and how does it differ from other coronaviruses?

PHEV is a betacoronavirus that causes vomiting and wasting disease and/or encephalomyelitis in suckling pigs . Key characteristics include:

FeatureDescription
ClassificationBetacoronavirus, single antigenic type
Host rangePigs are the only known natural host
Unique propertyOnly neurotropic coronavirus affecting swine
Clinical manifestationAge-dependent, typically only in piglets <4 weeks old
TransmissionRespiratory droplets
Cellular effectFormation of syncytia in porcine cell cultures
Special propertyAbility to agglutinate erythrocytes

Unlike most coronaviruses, PHEV can invade the central nervous system, which indicates the involvement of neurobiological pathways that might be related to multiple cellular receptors in respiratory, digestive, and nervous system tissues .

Advanced Research Questions

  • What methods are most effective for detecting recombination events in PHEV genomic sequences?

Recombination detection in PHEV and related viruses requires multiple computational approaches. Based on methodologies described for PRRSV-2 , the following workflow is recommended:

  • Sequence alignment of potential recombinants with reference strains

  • Analysis using RDP4 software (v.4.101) with multiple detection algorithms:

    • RDP

    • GENECONV

    • BootScan

    • MaxChi

    • Chimera

    • SiScan

    • 3Seq

A recombination event should be considered valid when supported by at least six of these seven methods . Confirmed events should be visualized using SimPlot version 3.5.1 with a 200-bp window sliding along the genome alignment (20-bp step size) .

The performance of different recombination detection methods varies based on sequence diversity and recombination frequency . For PHEV sequences with high diversity, GENECONV and 3SEQ perform better at detecting recombination in sequences with pairwise distance above 0.1, while gmos is more effective for sequences with distance below 0.1 .

  • How can researchers design effective reverse genetics systems for studying PHEV M protein function?

An effective reverse genetics system for PHEV would allow targeted manipulation of the M protein. Based on approaches used for other positive-strand RNA viruses , a circular polymerase extension reaction (CPER) method is recommended:

StepProcedureTechnical Considerations
1. DesignCreate overlapping cDNA fragments covering the full viral genomeInclude specific mutations in M protein region
2. AssemblyUse CPER to join fragments without bacterial cloningAvoids instability issues during propagation
3. TranscriptionInclude eukaryotic promoter for host RNA polymerase IIAlternatively use bacteriophage promoter for in vitro transcription
4. TransfectionUse TransIT X2 or similar reagent to transfect susceptible cellsTypically porcine cell lines
5. RecoveryCollect supernatant from transfected cells as inoculumUse for infection of naïve cells
6. VerificationDetermine infectious titers via FFU, TCID50, or PFU assaysConfirm sequence by Sanger method
7. CharacterizationAssess growth kinetics at multiple timepointsCompare wild-type and mutant viruses

This approach has been successfully applied to hepatitis A virus, bovine viral diarrhea virus-1, and encephalomyocarditis virus , suggesting feasibility for PHEV.

  • How does the M protein interact with other viral components to affect pathogenesis?

Based on studies of related viruses like measles , the M protein likely interacts with multiple viral components:

  • M-N protein interaction: In measles virus, the M protein interacts with the N protein to regulate viral RNA synthesis. This interaction requires specific leucine residues in the N protein's C-terminus .

  • Membrane association: The M protein associates with the inner surface of the plasma membrane and potentially with cytoplasmic tails of viral glycoproteins .

  • RNA synthesis regulation: M protein modulates viral RNA synthesis, potentially by retention of the ribonucleoprotein complex at the plasma membrane .

Methodologically, these interactions can be studied using:

  • Yeast two-hybrid screening to identify interaction partners

  • Co-immunoprecipitation to confirm direct interactions

  • SDS-PAGE and Western blotting with specific antibodies

  • Confocal microscopy to visualize protein co-localization

  • Minigenome assays to assess effects on viral RNA synthesis

Methodological Questions

  • What experimental infection models are most effective for studying PHEV pathogenesis?

Based on published research , cesarean-derived, colostrum-deprived (CDCD) neonatal pigs serve as an optimal model for PHEV pathogenesis studies:

Experimental ParameterOptimal Approach
Animal modelCDCD neonatal pigs
Inoculation routeOronasal
Clinical monitoring period2-13 days post-inoculation
Sample collectionNasal secretions (1-10 dpi), feces (2-7 dpi), tissues at necropsy
Detection methodRT-qPCR for viral RNA
Ex vivo modelALI-PRECs system
Observed changesRespiratory, enteric, and neurological clinical signs

The ALI-PRECs (air-liquid interface CDCD-derived porcine respiratory cells culture) system provides a valuable complementary ex vivo model that confirms the tracheal epithelia as a primary infection site . This system shows active virus replication with increasing levels of PHEV RNA detected in platewell subnatants over 48 hours of infection .

  • What approaches can be used to study the structure-function relationship of recombinant PHEV M protein?

To investigate PHEV M protein structure-function relationships, researchers should consider:

ApproachApplicationAdvantages
X-ray crystallographyHigh-resolution structure determinationProvides atomic-level details of protein structure
Cryo-electron microscopyVisualization in native stateCan show protein orientation relative to viral membrane
Site-directed mutagenesisIdentify functional domainsTests specific amino acid contributions to function
Protein expression systemsGenerate recombinant proteinOptions include E. coli, yeast, insect, and mammalian cells
Membrane interaction studiesAssess lipid binding propertiesImportant for understanding assembly process

For examining M protein in the context of virions, Volta phase plate cryo-electron tomography can be employed to determine protein orientation with respect to the viral membrane, as demonstrated for other viral envelope proteins .

Functional studies should include:

  • Creation of M protein mutants using the reverse genetics system

  • Assessment of mutant effects on viral replication and assembly

  • Protein-protein interaction assays with other viral components

  • Localization studies in infected cells using immunofluorescence

  • What methods should be used to detect and quantify PHEV M protein expression in experimental settings?

For detection and quantification of PHEV M protein:

MethodApplicationSensitivity Considerations
Western blottingProtein expression levelsRequires specific anti-M antibodies
ImmunofluorescenceCellular localizationFixation method affects membrane protein epitopes
Mass spectrometryProtein identification/quantificationSample preparation critical for membrane proteins
Flow cytometryCell surface expressionUseful for intact cells if M protein is accessible
ELISAQuantification in samplesRequires validated antibody pairs

When working with membrane proteins like M, special considerations include:

  • Using appropriate detergents for solubilization (e.g., Triton X-100, NP-40)

  • Optimizing sample preparation to maintain protein structure

  • Including controls for membrane fraction purity

  • Using multiple antibodies targeting different epitopes for validation

  • How can researchers optimize the expression and purification of recombinant PHEV M protein for structural studies?

For optimal expression and purification of PHEV M protein:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effectiveMay require refolding, lacks post-translational modifications
Insect cellsBetter folding, some modificationsModerate yield, more complex than bacteria
Mammalian cellsNative-like folding and modificationsLower yield, highest cost, most complex

Purification strategy should include:

  • Affinity tags (His, FLAG, etc.) for initial capture

  • Detergent selection critical for membrane protein solubilization (test panel including DDM, LMNG, etc.)

  • Size exclusion chromatography for final polishing

  • Verification of protein integrity via mass spectrometry

  • Functional validation through binding assays

For structural studies, protein stability optimization is essential:

  • Screen multiple buffer conditions (pH, salt, additives)

  • Assess thermal stability using differential scanning fluorimetry

  • Consider lipid nanodisc or amphipol reconstitution for maintaining native structure

  • Verify homogeneity by dynamic light scattering before structural biology experiments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.