Recombinant Porcine reproductive and respiratory syndrome virus Glycoprotein 4 (GP4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Porcine Reproductive and Respiratory Syndrome Virus Glycoprotein 4 (GP4)

Porcine reproductive and respiratory syndrome virus (PRRSV) is a significant pathogen affecting pigs worldwide, causing substantial economic losses in the swine industry. Among its envelope proteins, Glycoprotein 4 (GP4) plays a crucial role in viral attachment and entry into host cells. Recombinant GP4 refers to genetically engineered versions of this protein, often used in research and vaccine development to understand and combat PRRSV infections.

Structure and Function of GP4

GP4 is one of the minor envelope glycoproteins of PRRSV, alongside GP2a and GP3. It is essential for forming multiprotein complexes with other glycoproteins and interacting with the host cell receptor CD163 . The interaction between GP4 and CD163 is critical for viral entry into susceptible host cells .

ProteinFunctionInteractions
GP4Viral attachment, interglycoprotein interactionsStrong interaction with GP5, interacts with CD163
GP2aViral attachment, forms multiprotein complexInteracts with CD163, other GPs
GP3Highly glycosylated, involved in immune evasionInteracts with GP2a and GP4, host proteins

Role of GP4 in PRRSV Infection

GP4, along with GP2a, acts as a viral attachment protein, facilitating the interaction with the CD163 receptor on host cells . This interaction is crucial for the initiation of PRRSV infection. The carboxy-terminal residues of CD163 are not required for this interaction, although they are necessary for conferring susceptibility to PRRSV infection in certain cell lines .

Recombinant GP4 in Research and Vaccine Development

Recombinant GP4 is used in various studies to understand its role in PRRSV infection and to develop effective vaccines. By expressing GP4 in recombinant systems, researchers can study its interactions with other viral proteins and host receptors in detail. This information is vital for designing vaccines that target GP4 or other envelope proteins to prevent PRRSV infection .

Research Findings and Data

Recent studies have highlighted the importance of GP4 in forming heteromultimeric complexes with other envelope proteins, which are essential for viral infectivity . The deletion of GP4 can significantly impact the assembly and infectivity of PRRSV, making it a potential target for therapeutic interventions .

StudyMethodologyKey Findings
Coimmunoprecipitation assaysStrong interaction between GP4 and GP5; GP4 interacts with CD163
Gene knockout experimentsGP4 is crucial for viral infectivity; forms complexes with other envelope proteins
Complementation assaysGP4-deficient PRRSV shows reduced infectivity

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
GP4; 4; Glycoprotein 4; Protein GP4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-183
Protein Length
Full Length of Mature Protein
Species
Porcine reproductive and respiratory syndrome virus (strain Lelystad) (PRRSV)
Target Names
GP4
Target Protein Sequence
CKPCFSTHLSDIETNTTAAAGFMVLQDINCFRPHGVSAAQEKISFGKSSQCREAVGTPQY ITITANVTDESYLYNADLLMLSACLFYASEMSEKGFKVIFGNVSGVVSACVNFTDYVAHV TQHTQQHHLVIDHIRLLHFLTPSAMRWATTIACLFAILLAI
Uniprot No.

Target Background

Function
Minor envelope protein. In conjunction with GP2a, it functions as a viral attachment protein, mediating interactions with CD163 and facilitating virus entry into susceptible host cells.
Protein Families
Arteriviridae GP4 protein family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host endoplasmic reticulum membrane; Single-pass type I membrane protein. Host Golgi apparatus membrane; Single-pass type I membrane protein. Secreted.

Q&A

What is the structural and functional significance of GP4 in PRRSV?

GP4 is a minor envelope glycoprotein of PRRSV that serves multiple critical functions in viral pathogenesis. Structurally, GP4 interacts strongly with the major glycoprotein GP5 and forms complexes with other minor envelope glycoproteins (GP2a and GP3). Functionally, GP4 is essential for mediating interglycoprotein interactions and, together with GP2a, serves as a viral attachment protein responsible for mediating interactions with the CD163 receptor for virus entry into susceptible host cells .
The carboxy-terminal 223 residues of the CD163 molecule are not required for interactions with GP4, although these residues are necessary for conferring susceptibility to PRRSV infection in certain cell lines like BHK-21 . This interaction between GP4 and CD163 represents a critical step in the viral infection cycle, making GP4 an important target for vaccine development and antiviral strategies.

How does GP4 contribute to PRRSV immune evasion?

GP4 contains a highly variable neutralizing epitope that is susceptible to immunoselection by antibodies. When PRRSV is cultivated in vitro in the continuous presence of neutralizing monoclonal antibodies (mAbs) directed against this epitope, selection of mAb-resistant PRRSV strains occurs within just five passages .
Comparison of the GP4 amino acid sequence of the original PRRSV strain with the GP4 amino acid sequences of the mAb-resistant strains reveals specific amino acid substitutions within this epitope . This rapid adaptation demonstrates how GP4 contributes to PRRSV's ability to evade host immune responses, which partially explains the persistent nature of PRRSV infections and the challenges in developing effective vaccines.

What methodologies are used to study GP4-CD163 interactions?

To study GP4 interactions with CD163 and other viral glycoproteins, researchers typically clone each of the viral glycoproteins and the CD163 receptor in expression vectors. After transfection into appropriate cell lines, their expression and interaction can be examined using techniques such as:

What are the mechanisms driving recombination events involving GP4 in PRRSV?

Recombination in PRRSV is a pervasive phenomenon and a key strategy for accelerating viral evolution. For recombination to occur, co-infection with two (or more) strains must happen in the same host and the same cell simultaneously . The recombination pattern in PRRSV constantly changes, with varying recombination hotspots in different patterns .
Analysis of recombination events shows that the nsp2-ORF5 region (which includes GP4) is particularly prone to recombination. Researchers use specialized software like RDP4 to detect recombination events and breakpoints, considering an event valid if supported by at least six of seven available parameters (RDP, GENECONV, BootScan, MaxChi, Chimera, SiScan, and 3Seq) . Visualization tools like SimPlot help confirm and visualize recombination breakpoints using sliding window analyses.
The susceptibility of PRRSV lineages to recombination varies, with evidence suggesting lineage 1 (L1) PRRSV is particularly prone to recombination events both in China and the United States . The recombination pattern has shifted over time, moving from an L8 to an L1 backbone between 2014 and 2018 in some regions .

How do researchers differentiate between natural recombination events and laboratory artifacts in GP4 sequence analysis?

Distinguishing natural recombination events from laboratory artifacts requires rigorous methodological approaches:

  • Multiple sequencing technologies: Researchers should verify recombination events using both Sanger sequencing and next-generation sequencing (NGS) to rule out technical artifacts.

  • Consistent detection in original samples: Recombination detected in virus isolates should be confirmed in the original clinical samples to exclude recombination during laboratory passage.

  • Statistical validation: Statistical methods implemented in recombination detection software (like RDP4) provide p-values for detected events, helping to distinguish real events from random sequence similarities.

  • Phylogenetic analysis: Constructing phylogenetic trees for different genomic regions can reveal incongruent evolutionary histories indicative of recombination.

  • Epidemiological context: Verification that potential parental strains circulate in the same geographical area provides support for natural recombination.
    In one documented case, NGS of both a virus isolate (USA/IN105404/2021) and the original lung sample confirmed the recombinant nature of a PRRSV strain derived from two modified live virus vaccines . Initially, contradictory PCR results (positive for one vaccine strain in the nsp2 region but matching another in the ORF5 region) suggested recombination, which was then confirmed through whole genome sequencing .

What are the implications of GP4 epitope variability for neutralizing antibody development and vaccine efficacy?

GP4's neutralizing epitope shows high variability and susceptibility to immunoselection, causing significant implications for vaccine development:

  • Antibody escape: When PRRSV is cultivated with neutralizing monoclonal antibodies targeting GP4, resistant strains emerge within just five passages due to amino acid substitutions within the epitope .

  • Cross-protection challenges: The variability in GP4 contributes to the limited cross-protection observed with current vaccines against heterologous PRRSV strains.

  • Vaccine design considerations: Effective vaccines must account for GP4 epitope diversity, possibly by including multiple variants or focusing on conserved regions.

  • Monitoring antigenic drift: Continuous surveillance of GP4 sequence changes is necessary to update vaccines as new escape variants emerge.
    The delayed and relatively weak cell-mediated immune response to PRRSV (taking 2-4 weeks post-vaccination to appear and peaking at approximately 32 weeks) further complicates vaccine efficacy . This delayed response contrasts sharply with other viral vaccines like pseudorabies virus MLV, which elicits T cell responses within 1 week of vaccination .

What are the optimal approaches for expressing and purifying recombinant GP4 for structural and functional studies?

For expressing and purifying recombinant GP4, researchers should consider these methodological approaches:

  • Expression systems:

    • Mammalian expression systems (HEK293, CHO cells) maintain proper glycosylation

    • Baculovirus-insect cell systems balance yield with post-translational modifications

    • Bacterial systems (with fusion tags) for non-glycosylated protein domains

  • Purification strategies:

    • Affinity chromatography using His-tag, GST-tag, or other fusion partners

    • Size exclusion chromatography to separate monomeric from aggregated forms

    • Ion exchange chromatography for further purification

  • Verification methods:

    • Western blotting with GP4-specific antibodies

    • Mass spectrometry for protein identification and modification analysis

    • N-terminal sequencing to confirm proper processing

    • Glycosylation analysis using enzymatic deglycosylation and lectin binding assays
      When designing GP4 expression constructs, researchers should consider removing the transmembrane domain to improve solubility while preserving the neutralizing epitope region. For structural studies, maintaining the native conformation is crucial, as the neutralizing epitope may be conformational rather than linear.

How can researchers effectively design experiments to study GP4 recombination events in vitro?

To study GP4 recombination events in vitro, researchers can follow these methodological approaches:

  • Co-infection model:

    • Select distinct PRRSV strains with genetic markers for identification

    • Infect susceptible cells (MARC-145 or primary alveolar macrophages) with both strains

    • Optimize multiplicity of infection (MOI) ratios to ensure co-infection

    • Isolate and plaque-purify potential recombinants

  • Molecular detection of recombinants:

    • Design strain-specific primers flanking potential recombination breakpoints

    • Perform nested RT-PCR to increase sensitivity

    • Sequence amplicons showing unexpected size or strain specificity patterns

    • Apply NGS for comprehensive detection of low-frequency recombinants

  • Recombination analysis:

    • Use recombination detection programs like RDP4 with multiple algorithms

    • Consider an event valid if supported by at least six of seven available detection methods

    • Visualize recombination using SimPlot with appropriate window sizes (e.g., 200-bp window with 20-bp step size)

  • Phenotypic characterization:

    • Compare growth kinetics of recombinants with parental strains

    • Assess neutralization susceptibility using strain-specific antibodies

    • Evaluate receptor binding and entry efficiency

    • Test pathogenicity in animal models when relevant
      By applying these methodologies, researchers have identified important recombination events in PRRSV, including a recombinant virus derived entirely from two modified live virus vaccine strains .

What techniques are most effective for analyzing the interaction between GP4 and the CD163 receptor?

To analyze GP4-CD163 interactions effectively, researchers can employ these methodological approaches:

  • Protein-protein interaction assays:

    • Co-immunoprecipitation (co-IP) using monospecific antibodies against GP4 or CD163

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in living cells

    • FRET/BRET assays to measure proximity-based energy transfer

    • Surface plasmon resonance (SPR) to determine binding kinetics and affinity

  • Mutagenesis approaches:

    • Alanine scanning mutagenesis to identify critical binding residues

    • Domain swapping between different PRRSV strains to map interaction regions

    • Deletion constructs to define minimal binding domains (as shown for CD163, where the carboxy-terminal 223 residues are not required for GP4 interaction)

  • Structural biology techniques:

    • X-ray crystallography of co-crystals containing GP4 and CD163 fragments

    • Cryo-electron microscopy of complexes

    • NMR spectroscopy for mapping interaction interfaces

    • Molecular dynamics simulations to model interaction dynamics

  • Cellular assays:

    • Flow cytometry to measure binding of recombinant GP4 to CD163-expressing cells

    • Cell-cell fusion assays to assess functional interactions

    • Virus infectivity assays using cells expressing wild-type or mutant CD163
      These techniques have revealed that both GP2a and GP4 proteins specifically interact with the CD163 molecule, with GP4 playing a particularly critical role in mediating interglycoprotein interactions and facilitating virus entry .

How should researchers address discrepancies between GP4 sequence data and functional studies?

When facing discrepancies between GP4 sequence data and functional studies, researchers should implement these methodological approaches:

What statistical approaches are most appropriate for analyzing GP4 genetic diversity and evolution?

For analyzing GP4 genetic diversity and evolution, these statistical and computational approaches are recommended:

  • Diversity measurements:

    • Nucleotide diversity (π) and haplotype diversity

    • Shannon entropy for measuring variability at specific sites

    • dN/dS ratio to detect selection pressure (positive, negative, or neutral)

    • Tajima's D test to distinguish between neutral evolution and selection

  • Phylogenetic analysis:

    • Maximum likelihood methods for tree construction

    • Bayesian approaches to estimate time to most recent common ancestor

    • Bootscanning to detect phylogenetic incongruities indicative of recombination

    • Estimation of substitution rates in different lineages

  • Recombination detection:

    • Multiple algorithm approach using RDP4 software (RDP, GENECONV, BootScan, MaxChi, Chimera, SiScan, and 3Seq)

    • SimPlot analysis using sliding windows (e.g., 200-bp window with 20-bp steps)

    • Breakpoint distribution analysis

    • Statistical assessment of recombination frequency

  • Epitope prediction and analysis:

    • Identification of sites under positive selection

    • Prediction of B-cell epitopes using machine learning approaches

    • Antigenic cartography to map antigenic relationships

    • Structural mapping of variable sites
      PRRSV recombination patterns have been shown to change over time, with varying recombination hotspots in different patterns . Statistical analyses have revealed that lineage 1 (L1) PRRSV is particularly susceptible to recombination events, with the major recombination pattern shifting from an L8 to an L1 backbone between 2014 and 2018 in some regions .

What are the major challenges in developing vaccines targeting GP4 neutralizing epitopes?

Developing vaccines targeting GP4 neutralizing epitopes faces several significant challenges:

  • Epitope variability and immunoselection:
    GP4 contains a highly variable neutralizing epitope that readily undergoes mutation under antibody pressure. Studies show that when PRRSV is cultivated with neutralizing monoclonal antibodies against this epitope, resistant strains emerge within just five passages due to amino acid substitutions .

  • Delayed and weak immune responses:
    PRRSV-specific cell-mediated immune responses appear approximately 2-4 weeks after vaccination, and the frequency of virus-specific T cells producing IFNγ peaks at approximately 32 weeks . This extremely delayed response (compared to other viral vaccines) complicates protection.

  • Recombination events:
    Recombination in PRRSV can lead to escape from vaccine-induced immunity. The emergence of recombinant strains derived from modified live virus vaccines is concerning, as these may retain the ability to replicate while evading vaccine-induced immunity .

  • Limited cross-protection:
    Current PRRS modified-live virus (MLV) vaccines confer protection against genetically homologous PRRSV but only partial protection against heterologous strains . This is partly due to the variability in neutralizing epitopes like those in GP4.

  • Safety concerns with live vaccines:
    PRRS MLV vaccines can revert to virulence and cause disease . Recombination between vaccine strains and field strains can potentially generate more virulent variants .
    Future vaccine development strategies should focus on conserved epitopes, multivalent approaches, and novel adjuvants to enhance the speed and strength of immune responses against diverse GP4 variants.

How can researchers better predict the emergence of recombinant GP4 variants with altered pathogenicity?

To better predict the emergence of recombinant GP4 variants with altered pathogenicity, researchers should consider these methodological approaches:

  • Enhanced surveillance systems:

    • Regular sampling and sequencing from diverse pig populations

    • Special focus on farms using multiple MLV vaccines

    • Real-time sequence data sharing through public databases

    • Implementation of next-generation sequencing for deep population sampling

  • Predictive modeling:

    • Machine learning algorithms trained on historical recombination data

    • Simulation of recombination events and their fitness consequences

    • Network analysis of virus transmission patterns

    • Integration of environmental and management factors that influence co-infection

  • Experimental validation:

    • Systematic testing of recombinants in in vitro systems

    • Animal models to assess pathogenicity of predicted recombinants

    • Competitive fitness assays between parental and recombinant strains

    • Immune escape studies with sera from vaccinated animals

  • Risk assessment framework:

    • Identify farming practices that increase recombination risk

    • Evaluate the impact of using multiple vaccines in the same populations

    • Consider geographic proximity of farms using different vaccines

    • Develop protocols to minimize co-circulation of diverse strains
      Evidence indicates that recombinant PRRSVs often have higher virulence than parental strains, and virulence reversion can be caused by recombination after using MLV vaccines . Enhanced adaptability of recombinant PRRSV for entry and replication facilitates their rapid propagation , underscoring the importance of predictive approaches.

What novel experimental systems could advance our understanding of GP4 function in PRRSV pathogenesis?

Several innovative experimental systems could significantly advance our understanding of GP4 function:

  • Advanced organoid models:

    • Porcine respiratory tract organoids to study tissue-specific infection dynamics

    • Co-culture systems with multiple cell types to model complex interactions

    • Microfluidic organ-on-chip platforms to simulate physiological conditions

    • Immune cell integration to assess GP4-mediated immune modulation

  • CRISPR/Cas9 applications:

    • Generation of GP4 epitope variants through precise genome editing

    • Creation of reporter viruses with tagged GP4 to track localization and interactions

    • Knockout of specific GP4 domains to assess functional importance

    • CD163 receptor modification to map interaction requirements

  • Structural biology approaches:

    • Cryo-electron microscopy of intact virions to visualize GP4 in its native context

    • Single-particle tracking to follow GP4 during virus entry

    • Super-resolution microscopy to map GP4 distribution during infection

    • In situ proximity labeling to identify transient interaction partners

  • Systems biology integration:

    • Transcriptomics, proteomics, and metabolomics of cells expressing GP4

    • Network analysis of GP4 interactions with host factors

    • Computational modeling of GP4 evolution under immune pressure

    • Multiscale models integrating molecular, cellular, and organism-level data By implementing these advanced experimental systems, researchers can gain deeper insights into how GP4 mediates its multiple functions in PRRSV pathogenesis, including receptor binding, interglycoprotein interactions, and immune evasion.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.