Recombinant Porcine reproductive and respiratory syndrome virus Glycoprotein 5 (GP5)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Porcine Reproductive and Respiratory Syndrome Virus Glycoprotein 5 (GP5)

Recombinant Porcine Reproductive and Respiratory Syndrome Virus Glycoprotein 5 (GP5) refers to a genetically engineered form of the GP5 protein derived from the Porcine Reproductive and Respiratory Syndrome Virus (PRRSV) . GP5 is the most abundant glycoprotein found on the surface of PRRSV particles, making it the major envelope glycoprotein . It contains approximately 200 amino acids, featuring a transmembrane region and an N-terminal extracellular domain with multiple antibody-neutralizing epitopes .

Structure and Genetic Variation of GP5

The GP5 protein includes a cleavable signal peptide at the N-terminus that directs protein synthesis to the rough endoplasmic reticulum and is predicted to contain three or four transmembrane domains . The extracellular domain consists of 35 amino acids, including two to five potential N-linked glycosylation sites, which are common antibody-neutralizing epitopes among PRRSV isolates .

GP5 is one of the most variable proteins in PRRSV, making it a basis for phylogenetic analysis and genetic evolution studies . Amino acid deletions, insertions, and mutations in the GP5 sequence can significantly influence viral virulence, proliferation, epidemiology, and the spread of PRRS .

Role of GP5 in PRRSV Infection and Immunity

GP5 protein plays a role in PRRSV infection, cell binding, and virus adsorption, and also in cell apoptosis . It contains essential immunogenic domains and peptide or protein motifs associated with virus-mediated neutralization, including signal peptides, transmembrane regions, antigenic clusters, and glycosylation sites that determine the biological functions of PRRSV .

GP5 is a key protein in the assembly of viral particles and is involved in the pathogenesis of viruses . It can induce both cellular and humoral immune responses and is a key target protein for neutralizing antibodies .

Glycosylation and Its Impact

Most PRRSV GP5 proteins contain three or more aspartate-linked glycosylation sites, and oligosaccharides may play a key role in the production of infectious PRRSV virus . These glycosylation sites are often adjacent to neutralizing epitopes, suggesting they may interfere with antibody binding . Glycosylation of GP5 can inhibit the production of neutralizing antibodies .

Interaction with Other Proteins

The transport of GP5 and M (a non-glycosylated protein) from the endoplasmic reticulum (ER) to the Golgi apparatus requires heterodimerization of M with GP5, suggesting that only properly assembled GP5/M complexes can pass through the ER quality control system . GP5/M heterodimers are integrated into virions and play an important role in the adsorption, assembly, and budding processes, and are essential for the formation of infectious virions .

Immunogenicity and Vaccine Development

GP5 protein is highly variable in PRRSV, playing an important role in virus infection and inducing protective antibodies in the host, making it a good target antigen for developing new vaccines . GP5 glycoprotein modified with Fc tags is an effective inducer of PRRSV-specific neutralizing antibodies, highlighting its potential in vaccine development . Immunization with recombinant baculovirus expressing GP5 and M proteins can trigger specific humoral and B cellular immune responses .
Pigs fed with GP5 transgenic tobacco leaves can develop specific mucosal and systemic humoral and cellular immune responses against PRRSV .

GP5 and Viral Replication

GP5 protein plays an important role in PRRSV replication . Stable expression of GP5 in Marc-145 cells promotes virus replication at the early stage of PRRSV infection by downregulating interferon (IFN) expression, while interfering with GP5 expression inhibits PRRSV replication . The second extracellular region of GP5 plays a regulatory role in PRRSV replication .

GP5 as a Target for Diagnosis and Control

Given its role in influencing the invasion, replication, and pathogenicity of PRRSV, GP5 protein could be a promising target for developing drugs and diagnostic reagents . Continuous monitoring of the highly variable GP5 protein is essential for updating our understanding of the evolving epidemiological dynamics of PRRSV, contributing to the prevention and control of future PRRS outbreaks .

GP5 and Cell Apoptosis

GP5 protein not only plays a role in PRRSV infection, cell binding, and virus adsorption but also in cell apoptosis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GP5; 5; Glycoprotein 5; Protein GP5; G(L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-201
Protein Length
Full Length of Mature Protein
Species
Porcine reproductive and respiratory syndrome virus (isolate Pig/United States/SD 01-08/2001) (PRRSV)
Target Names
GP5
Target Protein Sequence
DGNGNNSTYQYIYNLTICELNGTNWLSGHFEWAVETFVLYPVVTHILSLGFLTTSHFFDA LGLGAVSTAGFVGGRYVLSSVYGACAFAAFVCFVIRAAKNCMACRYARTRFTNFIVDDRG GVHRWKSPIVVEKLGKAEIGGNLVTIKHVVLEGVKAQPLTRTSAEQWEA
Uniprot No.

Target Background

Function
A major envelope protein abundantly present in virions. It mediates sialic acid-dependent attachment to the SIGLEC1 sialoadhesin receptor, triggering virion internalization into alveolar macrophages primarily via clathrin-dependent endocytosis.
Protein Families
Arteriviridae GP5 protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of PRRSV GP5?

GP5 consists of approximately 200 amino acids structured into three or four predicted transmembrane domains. The protein contains an N-terminal cleavable signal peptide that directs protein synthesis to the rough endoplasmic reticulum. The ectodomain comprises 35 amino acids that include several putative N-glycosylation sites and contains a neutralizing antibody epitope that is broadly shared by PRRSV isolates . The structural organization of GP5 is critical for its function in virus assembly and host cell invasion. GP5's topological analysis suggests it contains an N-terminal signal peptide, two ectodomains, two transmembrane domains, and a C-terminal cytoplasmic domain .

What are the key functions of GP5 in the PRRSV life cycle?

GP5 serves multiple essential roles in the PRRSV life cycle. It is indispensable for virus particle assembly and replication within susceptible cells . Research has demonstrated that GP5 promotes virus replication at the early stage of PRRSV infection through downregulation of interferon expression, particularly when stably expressed in Marc-145 cells . Conversely, specific regions of GP5 (D84-119) can inhibit PRRSV replication by upregulating IFN expression, especially IFN-β, indicating a regulatory role in viral replication . Additionally, GP5 has good immunogenicity and can induce neutralizing antibodies, making it significant for both viral pathogenesis and host immune response .

What are the optimal methods for recombinant GP5 expression?

For recombinant GP5 expression, several methodological approaches have proven effective. The E. coli expression system has been successfully employed using the pGEM-ORF5 vector, with His-tagged GP5 being expressed predominantly in soluble form . The expression conditions typically involve optimizing temperature (often lowered to 16-25°C after induction), IPTG concentration (0.2-1.0 mM), and induction time (4-16 hours) to maximize protein yield while maintaining proper folding. Alternative expression systems, including baculovirus-insect cell systems or mammalian cell cultures, may be preferred when post-translational modifications (particularly glycosylation) are essential for the research objectives.

What purification strategies yield the highest purity of recombinant GP5?

A two-step chromatography approach combining immobilized metal affinity chromatography (IMAC) and hydrophobic interaction chromatography (HIC) has been demonstrated to achieve high purity recombinant GP5. Specifically, His-tagged GP5 can be initially purified using Ni²⁺-chelating Sepharose Fast Flow, yielding approximately 80.5% recovery with 48% purity . The partially purified protein can then be subjected to HIC to achieve a final purity of 95% .

The purification protocol typically involves:

  • Cell lysis under native conditions (using lysozyme and sonication)

  • Clarification of lysate by centrifugation

  • IMAC using imidazole gradient elution

  • Buffer exchange to remove imidazole

  • HIC using decreasing salt gradient

  • Final buffer exchange to physiological conditions

This approach yields monomeric recombinant GP5, which differs from the dimeric or tetrameric forms observed when GP5 is purified directly from PRRSV virions .

How do glycosylation patterns of GP5 influence PRRSV virulence and immune evasion?

GP5 contains multiple N-glycosylation sites that significantly impact viral virulence and immune evasion strategies. Research on PRRSV strains from Vietnam identified several N-glycosylation site mutations (4 in PRRSV-1 and 6 in PRRSV-2), particularly at residues 33, 34, 35, and 51 of PRRSV-2 GP5 protein . These mutations potentially play crucial roles in immune evasion or altered virulence.

While all four glycosylation sites of PRRSV-1 were generally conserved (with mutations observed only in a few individual strains), the N51 site in Vietnamese PRRSV-2 strains showed relative conservation . Previous research has established that N-glycosylation at positions N34, N44, and N51 is required for the production of infectious PRRSV strain 97-7895 . Some PRRSV strains (like SD16) possess additional glycosylation sites at N30 and N35 beyond the common N44 and N51 positions .

Interestingly, de-glycosylation experiments using PNGase F showed that while the treatment produced GP5 of different molecular sizes, the de-glycosylated GP5 still interacted with the host factor MYH9, indicating that N-glycosylation of GP5 is not essential for this particular host interaction . This suggests a complex role for glycosylation in GP5 function, potentially more relevant to immune evasion than certain host receptor interactions.

What specific mutations in GP5 are associated with increased virulence?

Comparative studies of GP5 sequences have identified several mutations potentially associated with increased virulence or altered pathogenicity:

  • Amino acid mutations at positions 39 and 57 of GP5 contribute to virus evasion of host immune responses

  • Positions 187-200 in both PRRSV-1 and PRRSV-2 are instrumental in cross-neutralization reactions for antibody formation

  • Specific mutations in PRRSV-2 sublineage L1A include:

    • A novel deletion mutation at position 37

    • A lineage-specific mutation (L47I)

    • Four Vietnam strain-specific mutations (F26I, D61E, L145V, and E170I)

  • PRRSV-1 subtype 1 (Global) shows specific mutations at H5C and A201V

The connections between these mutations and specific virulence phenotypes require further investigation, as the associations between genetic changes and epidemiological outcomes remain incompletely understood.

What strategies have proven most effective for GP5-based vaccine development?

GP5-based vaccine development has explored multiple strategies, leveraging the protein's immunogenicity and ability to induce neutralizing antibodies. Effective approaches include:

  • Subunit vaccines: Purified recombinant GP5 (95% purity) produced through combined IMAC and HIC purification strategies has shown promise as a subunit vaccine component . These vaccines typically require adjuvants to enhance immunogenicity.

  • DNA vaccines: Plasmids encoding GP5 can induce both humoral and cell-mediated immune responses, with the advantage of not requiring cold-chain storage.

  • Vectored vaccines: GP5 expressed in viral vectors (adenovirus, vaccinia) or bacterial vectors can enhance immune responses compared to subunit approaches.

  • Chimeric/modified GP5 constructs: Engineering GP5 to expose neutralizing epitopes that are normally shielded by glycosylation or to include immunostimulatory molecules has shown enhanced vaccine efficacy.

For optimal vaccine design, researchers should consider targeting conserved neutralizing epitopes within GP5 while accounting for the genetic diversity observed across PRRSV strains and lineages. The amino acid positions 187-200, which are involved in cross-neutralization reactions, represent particularly valuable targets .

How can researchers address the challenge of GP5 genetic diversity in vaccine design?

Addressing GP5 genetic diversity requires multi-faceted approaches:

  • Phylogenetic analysis: Comprehensive examination of GP5 sequences from diverse geographical regions, as exemplified by the analysis of 271 PRRSV GP5 sequences from Vietnam (2007-2023), helps identify predominant lineages and emerging variants . PRRSV-1 strains in Vietnam belong to subtype 1 (Global), while PRRSV-2 strains are distributed across lineages 1, 5, and 8, with lineage 8 being predominant .

  • Conserved epitope identification: Comparing sequences across lineages reveals conserved regions suitable as vaccine targets. For example, while PRRSV-2 strains show greater amino acid variation in neutralizing and T-cell epitopes compared to PRRSV-1 strains, certain regions remain relatively conserved .

  • Multivalent vaccine formulations: Including GP5 sequences from multiple predominant lineages can provide broader protection.

  • Consensus sequence approach: Designing artificial GP5 sequences that represent the consensus across multiple strains can potentially induce broader cross-protection.

  • Monitoring genetic evolution: Regular surveillance of circulating PRRSV strains, as shown in the Vietnam study where 2023 isolates were identified as lineage 8 strains, allows vaccine formulations to be updated as the virus evolves .

These approaches, used in combination, offer the most promising strategy for overcoming the challenges posed by GP5 genetic diversity in vaccine development.

How does GP5 interact with MYH9, and what is the significance of this interaction?

GP5 directly interacts with non-muscle myosin heavy chain 9 (MYH9) through its first ectodomain (GP5-ecto-1). This interaction occurs with the C-terminal domain of MYH9, known as the PRA region . The GP5-MYH9 interaction induces filamentous aggregates of recombinant PRA proteins in vitro and of endogenous MYH9 in vivo . These MYH9 aggregates facilitate viral internalization in both MARC-145 cells and porcine alveolar macrophages (PAMs) .

Mechanistically, GP5 preferentially interacts with the dimerized form of PRA, but not with S100A4-dissociated monomeric PRA . This interaction specificity suggests a precise molecular mechanism for PRRSV cell entry. The regulatory protein S100A4 can disassemble these aggregates, and experimental introduction of S100A4 protein expression in MARC-145 cells significantly diminished MYH9 aggregation, ultimately inhibiting PRRSV internalization and infection regardless of PRRSV genotype .

Importantly, this GP5-MYH9 interaction is independent of GP5 glycosylation status. Experiments using neuraminidase (to modify sialic acid) or PNGase F (to remove N-linked oligosaccharides) demonstrated that de-glycosylated GP5 still interacts with MYH9 . This finding contrasts with earlier studies showing that PRRSV attachment to permissive cells could be blocked by neuraminidase or PNGase F treatment, suggesting multiple attachment mechanisms.

What experimental methods are most effective for studying GP5-host protein interactions?

Several methodological approaches have proven effective for investigating GP5-host protein interactions:

  • Co-immunoprecipitation (Co-IP): This technique successfully demonstrated the interaction between GP5 and MYH9, even after glycosylation modification . The protocol typically involves:

    • Expression of tagged GP5 in mammalian cells (e.g., MARC-145-GP5)

    • Cell lysis under conditions that preserve protein-protein interactions

    • Immunoprecipitation using antibodies against the tag (e.g., anti-Flag mAb)

    • Western blot analysis of the precipitated complex

  • Truncation analysis: This approach identified the GP5-ecto-1 domain as responsible for MYH9 interaction . The method involves:

    • Creating a series of GP5 truncation mutants

    • Expressing these mutants in mammalian cells

    • Performing Co-IP experiments to identify which regions maintain interaction

  • Recombinant protein interaction assays: In vitro studies using purified recombinant proteins can demonstrate direct interactions and study aggregation phenomena .

  • Fluorescence microscopy: This technique can visualize protein co-localization and aggregation in living cells, as demonstrated for MYH9 filamentous aggregates .

  • Protein modification treatments: Enzymatic treatments (like neuraminidase or PNGase F) help determine whether post-translational modifications affect protein interactions .

For comprehensive characterization of GP5-host interactions, combining multiple approaches provides the most robust evidence and mechanistic insight.

How can researchers effectively analyze GP5 genetic evolution and recombination events?

Analysis of GP5 genetic evolution and potential recombination events requires sophisticated bioinformatic approaches:

  • Sequence collection and alignment: Gathering comprehensive sequence datasets from global databases and regional isolates is essential. For example, the Vietnam study analyzed 271 PRRSV GP5 sequences collected from 2007 to 2023 .

  • Homology analysis: Software tools like GraphPad Prism (Version 9.0.0) and the Clustal W method in DNASTAR software (Version 7.0) can be used to analyze nucleotide and amino acid homologies .

  • Recombination detection: Multiple algorithmic approaches should be employed simultaneously:

    • The RDP, GENECONV, BootScan, MaxChi, Chimera, SiScan, and 3Seq algorithms in RDP software (Version 4.0) can identify potential recombination events

    • Strains yielding four or more positive results with p < 0.05 across these algorithms can be considered recombinant strains

  • Phylogenetic analysis: Construction of phylogenetic trees is essential for classifying strains into lineages and sublineages. Reference sequences from established classification systems should be included to properly contextualize new isolates .

  • Epitope and functional domain mapping: Identifying mutations in neutralizing epitopes, T-cell antigenic regions, and other functional domains provides insight into the evolutionary pressures on GP5 .

The Vietnam study found no significant recombination events in GP5 across 344 PRRSV genomes , suggesting that point mutations rather than recombination may be the primary driver of GP5 evolution in these populations.

What are the most promising approaches for studying the role of GP5 in PRRSV pathogenesis?

Advanced research into GP5's role in PRRSV pathogenesis employs several sophisticated approaches:

  • Reverse genetics systems: Creating recombinant viruses with specific GP5 mutations allows direct testing of how GP5 variants affect viral replication, cell tropism, and virulence in vitro and in vivo.

  • Interference experiments: Using siRNA to interfere with GP5 expression has demonstrated inhibition of PRRSV replication, confirming GP5's essential role .

  • Domain-specific expression studies: Expression of specific GP5 domains (such as GP5 D84-119) has revealed regulatory roles in viral replication through modulation of interferon responses .

  • Protein-protein interaction networks: Comprehensive identification of GP5 interaction partners using techniques like proximity labeling, mass spectrometry, and yeast two-hybrid screening can reveal the broader impact of GP5 on cellular processes.

  • In vivo pathogenesis models: Comparing the pathogenicity of PRRSV strains with different GP5 variants in pigs provides the most relevant data on how GP5 affects disease outcomes.

  • Transcriptomic and proteomic approaches: Analyzing cellular responses to GP5 expression or to infection with PRRSV variants differing in GP5 structure can identify pathways modified by GP5.

These approaches collectively provide a comprehensive understanding of GP5's multifaceted roles in PRRSV pathogenesis, from initial viral attachment to immune modulation and virion assembly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.