Recombinant Porcine respiratory coronavirus Membrane protein (M)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant M proteins are typically expressed in E. coli or eukaryotic systems (e.g., BHK-21 cells). Key methodologies include:

Expression Systems

SystemDetailsReference
E. coli BL21 (DE3)pETSUMO vector; SUMO tag for solubility.
BHK-21 cellsCo-expressed with PRRSV GP5 in pseudorabies virus (PRV) vectors.

Purification and Validation

  • Purification: Affinity chromatography (e.g., His-tag purification) .

  • Verification: SDS-PAGE (molecular weight ~37.7 kDa for PDCoV M) , Western blot, and functional ELISA .

Immunogenicity in Mice

Studies using PDCoV M protein (rM-PDCoV) demonstrated robust antibody responses:

TimepointAntibody TiterSignificance
Day 7DetectableEarly immune recognition .
Day 28Peak levelsSustained humoral response (p < 0.001) .

Cross-Reactivity

  • PDCoV vs. PEDV/TGEV: No cross-reactivity observed with sera from PEDV- or TGEV-infected pigs .

  • Conserved Epitopes: Shared antigenic regions among PDCoV strains enable broad immune targeting .

Applications in Vaccine Development

The M protein’s conserved nature makes it a candidate for bivalent vaccines:

Recombinant PRV Vaccines

VaccineComponentsOutcomeReference
rPRV-NC56PRRSV GP5 + M proteinsInduced PRV/PRRSV-specific immunity; 100% mouse protection against PRV .
rM-PDCoVPDCoV M proteinNeutralizing antibodies in mice; potential for PDCoV-specific vaccines .

Mechanism

  • Virus-Like Particles (VLPs): Co-expression of M with other structural proteins (e.g., E, S) enables VLP formation, enhancing immunogenicity .

  • Immune Modulation: M protein stimulates T- and B-cell responses, as observed in SARS-CoV and IBV models .

Research Gaps and Future Directions

  • Broad-Spectrum Vaccines: Leveraging M protein’s conservation for pan-coronavirus vaccines.

  • Diagnostic Tools: Development of M-based ELISA kits for rapid PDCoV/PRCoV detection.

  • Therapeutic Targets: Exploring M protein inhibitors to disrupt viral assembly.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your required tag type in advance for prioritized development.
Synonyms
M; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-262
Protein Length
Full Length of Mature Protein
Species
Porcine respiratory coronavirus (strain RM4) (PRCoV) (PRCV)
Target Names
M
Target Protein Sequence
RYCAMKDDTGLSCRNGTASDCESCFNRGDLIWLLANWNFSWSIILIIFITVLQYGRPQFS WFVYGIKMLIMWLLWPIVLALTIFNAYSEYQVSRYVMFGFSIAGAIVTFVLWIMYFVRSI QLYRRTKSWWSFNPETNAILCVSALGRSYVLPLEGVPTGVTLTLLSGNLYAEGFKIAGGM TIDNLPKYVMVALPSRTIVYTLVGKKLKASSATGWAYYVKSKAGDYSTEARTDNLSEQEK LLHMV
Uniprot No.

Target Background

Function
A viral envelope component crucial for virus morphogenesis and assembly through interactions with other viral proteins.
Protein Families
Alphacoronaviruses M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of the PRCV Membrane protein?

The PRCV Membrane (M) protein is a transmembrane glycoprotein crucial for coronavirus particle assembly and budding. As one of the major structural proteins in PRCV, it features three transmembrane domains, a short amino-terminal ectodomain, and a large carboxy-terminal endodomain. The M protein plays essential roles in viral envelope formation through interactions with other structural proteins, particularly the nucleocapsid (N) protein.

PRCV, a deletion mutant of transmissible gastroenteritis virus (TGEV), contains an M protein that shares approximately 97-98% sequence homology with TGEV's M protein . Despite this genetic similarity, the M protein contributes to the distinct tropism of PRCV (respiratory) compared to TGEV (enteric) .

How are PRCV M gene primers designed for molecular detection?

Designing effective primers for the PRCV M gene requires careful consideration of conserved regions across related coronaviruses. According to research methodologies, primers targeting the M gene are typically designed by:

  • Performing multiple sequence alignment of available PRCV, TGEV, and related coronavirus M gene sequences from genetic databases

  • Identifying highly conserved regions specific to PRCV

  • Evaluating primer pairs for optimal annealing temperature, GC content, and minimal secondary structure formation

One established approach uses primers designed from conserved regions of multiple coronavirus sequences (including TGEV and PRCV): forward primer 5'-AYCTTRSAAACTGGAAYTTC-3' and reverse primer 5'-ACATAGWAAGCCCAWCCAGT-3', which target positions 25722-25741 and 26258-26277, respectively, based on reference sequences . These primers amplify a 439-nucleotide fragment of the M gene that can be used for virus identification and phylogenetic analysis.

What expression systems are most effective for producing recombinant PRCV M protein?

The production of functional recombinant PRCV M protein requires careful selection of expression systems. Based on coronavirus research methodologies, the following approaches yield optimal results:

  • Mammalian expression systems: Swine testicular (ST) cells represent the gold standard for PRCV protein expression as they support proper folding and post-translational modifications of viral proteins . Culturing conditions typically involve Modified Eagle's Medium (MEM) supplemented with 10% fetal bovine serum, L-glutamine, and antibiotics at 37°C with 5% CO₂ .

  • Bacterial expression systems: While E. coli-based systems allow for high-yield production, they often require extensive optimization for membrane proteins. Fusion tags (His, GST, or MBP) facilitate purification but may affect protein functionality.

  • Insect cell systems: Baculovirus expression systems provide advantages for membrane protein production with proper glycosylation patterns, though yields may be lower than bacterial systems.

When evaluating expression systems, researchers should consider the intended downstream applications, required protein conformation, and whether glycosylation is essential for the specific research objectives.

How can researchers differentiate between antibodies against PRCV and TGEV M proteins in serological assays?

Differentiating between PRCV and TGEV antibodies represents a significant challenge in coronavirus research due to their high sequence homology. Current methodological approaches include:

  • Blocking ELISAs: Commercial differential ELISAs primarily target the spike (S) protein rather than the M protein, as the S protein contains the major antigenic differences between PRCV and TGEV . These assays exploit the large deletion in the amino terminus of the PRCV S protein to differentiate antibody responses.

  • Epitope mapping approaches: For M protein-specific differentiation, researchers must identify unique epitopes. M protein contains fewer distinguishing epitopes than the S protein, making this approach more challenging.

  • Competitive binding assays: Using M protein-derived peptides specific to PRCV or TGEV can help distinguish antibody origins in competitive ELISA formats.

It's important to note that all commercial TGEV/PRCV blocking ELISAs show significant cross-reactivity between TGEV and PRCV serum antibodies, particularly during early infection stages . This cross-reactivity appears to be TGEV strain-dependent, with a higher percentage of PRCV-false-positive results for pigs inoculated with TGEV Purdue than with TGEV Miller . Researchers should interpret individual test results with caution, especially when encountering "suspect" results.

What are the critical considerations for designing multiplexed PCR assays that include PRCV M gene detection?

Designing effective multiplexed PCR assays that include PRCV M gene detection requires careful optimization of several parameters:

  • Primer design considerations:

    • Select regions with minimal sequence homology to other coronaviruses when specificity is required

    • Target conserved regions when detection of multiple coronavirus strains is desired

    • Ensure compatible melting temperatures across all primer sets

    • Verify minimal primer-dimer formation potential

  • Optimization protocol:

    • Determine analytical sensitivity using serial dilutions of reference isolates (e.g., PRCV AR310)

    • Validate with in vitro transcribed (IVT) RNA standards

    • Test with multiple replicates at low concentrations (20 replicates) to establish detection limits

    • Evaluate specificity against closely related coronaviruses

  • Controls implementation:

    • Include internal amplification controls (XIPC) to monitor for PCR inhibition

    • Use strain-specific positive controls

    • Incorporate no-template controls to detect contamination

The analytical sensitivity should be established using both viral isolates and synthetic RNA standards. For example, one validated approach used 3 replicates at high concentrations and 20 replicates at low concentrations for each dilution of IVT RNAs generated from PRCV gBlock DNA fragments .

How has the PRCV M protein evolved over time, and what are the implications for diagnostic test development?

The evolution of the PRCV M protein presents important considerations for diagnostic test development:

Research demonstrates that variant PRCV isolates from 2020 show higher viral shedding (measured by area under the curve) compared to traditional 1989 isolates , suggesting potential changes in viral replication efficiency that could impact diagnostic sensitivity. These findings emphasize the importance of using contemporary isolates when developing or validating diagnostic assays.

What methodologies are optimal for studying M protein interactions with other viral proteins during PRCV assembly?

Investigating M protein interactions during PRCV assembly requires sophisticated methodological approaches:

  • Co-immunoprecipitation (Co-IP) protocols:

    • Express recombinant M protein with epitope tags (FLAG, HA, etc.)

    • Lyse cells under conditions that preserve protein-protein interactions

    • Precipitate using antibodies against the tag or specific viral proteins

    • Analyze precipitated complexes by western blot or mass spectrometry

  • Proximity labeling approaches:

    • Express M protein fused to BioID or APEX2 enzymes

    • Allow proximity-dependent labeling of interacting proteins

    • Purify biotinylated proteins using streptavidin

    • Identify interaction partners by mass spectrometry

  • Fluorescence microscopy techniques:

    • Perform fluorescence resonance energy transfer (FRET) between labeled viral proteins

    • Utilize split-GFP complementation to visualize specific interactions

    • Implement live-cell imaging to track assembly dynamics

    • Apply super-resolution microscopy for detailed visualization of virion assembly sites

  • Cryo-electron microscopy:

    • Analyze purified virions to determine M protein arrangement

    • Study virus-like particles formed by M protein in the presence or absence of other structural proteins

These methodologies can be applied in PRCV-permissive cell culture systems such as swine testicular (ST) cells to study authentic viral assembly processes.

What are the current challenges in determining the structure of PRCV M protein and potential solutions?

Determining the structure of coronavirus M proteins presents significant challenges due to their membrane-embedded nature. Current challenges and methodological solutions include:

  • Expression and purification challenges:

    • Challenge: Membrane proteins are difficult to express in sufficient quantities and often aggregate during purification

    • Solution: Utilize specialized detergents (LMNG, DDM) or nanodiscs to maintain the native conformation; expression in specialized cell lines optimized for membrane proteins

  • Crystallization difficulties:

    • Challenge: Membrane proteins resist conventional crystallization approaches

    • Solution: Implement lipidic cubic phase crystallization methods; focus on crystallizing soluble domains separately; utilize antibody fragments to stabilize specific conformations

  • NMR spectroscopy limitations:

    • Challenge: Size constraints and signal overlap complicate NMR studies

    • Solution: Apply selective isotope labeling; focus on individual domains; use solid-state NMR approaches

  • Cryo-EM approaches:

    • Challenge: Small size of M protein limits resolution in single-particle analysis

    • Solution: Study M protein in the context of virus-like particles; apply tomographic approaches; use Fab fragments to increase particle size

  • Computational prediction challenges:

    • Challenge: Limited homology to proteins with known structures

    • Solution: Integrate co-evolutionary analysis; apply deep learning approaches (AlphaFold2); validate predictions with experimental constraints

The research community has made significant progress with other coronavirus M proteins, but PRCV M protein structural studies remain limited. Researchers can leverage tracheal organ cultures for producing authentic virus particles for structural studies, as demonstrated in PRCV pathogenesis research .

What are the optimal cell culture systems for studying PRCV M protein function?

Selecting appropriate cell culture systems is critical for studying PRCV M protein function. Based on established research methodologies:

  • Swine Testicle (ST) cell line: This fibroblast-like cell line (ATCC CRL-1746) serves as the gold standard for PRCV isolation and propagation . Culture protocols typically use:

    • Modified Eagle's Medium (MEM) with 10% fetal bovine serum

    • Supplements: 1% L-glutamine, 1% penicillin-streptomycin, 1% MEM Nonessential Amino Acids, and 1% sodium pyruvate

    • Incubation at 37°C with 5% CO₂

  • Tracheal Organ Cultures (TOCs): These ex vivo systems maintain the complexity of respiratory epithelium and allow study of M protein in the context of authentic viral infection . The preparation protocol involves:

    • Collection of tracheal rings (1-2 mm thickness)

    • Culture in specialized media

    • Incubation at 37°C with 7-8 revolutions per hour

    • Inoculation with PRCV at specified titers (typically 10⁴-10⁵ PFU)

  • Polarized respiratory epithelial cells: For studying directional virus release and M protein trafficking:

    • Culture cells on permeable supports (Transwell)

    • Verify epithelial integrity through transepithelial electrical resistance (TEER) measurements

    • Apply virus to either apical or basolateral surface

When evaluating M protein function specifically, researchers can use transfection-based expression in ST cells or other swine-derived cell lines. For infection studies, multiplicity of infection (MOI) of 0.1 is typically used, with time points collected at 0, 12, 24, 36, 48, 60, 72, and 96 hours post-infection to track the full infection cycle .

How can researchers quantitatively assess PRCV M protein expression in different experimental systems?

Quantitative assessment of PRCV M protein expression requires specialized methodologies suited to the experimental system:

  • Western blot quantification:

    • Sample preparation: Lyse cells in RIPA or NP-40 buffer with protease inhibitors

    • Protein separation: Use 12-15% SDS-PAGE gels optimized for membrane proteins

    • Transfer: Semi-dry or wet transfer to PVDF membranes (preferred for hydrophobic proteins)

    • Detection: Primary antibodies against M protein or epitope tags

    • Quantification: Normalize to housekeeping proteins; use standard curves with recombinant M protein

  • Flow cytometry protocols:

    • Fix cells with 4% paraformaldehyde

    • Permeabilize with 0.1% saponin or 0.5% Triton X-100

    • Block with 5% serum matching secondary antibody species

    • Stain with M protein-specific antibodies

    • Analyze percentage of positive cells and mean fluorescence intensity

  • qRT-PCR methodology:

    • Extract total RNA using commercial kits

    • Perform reverse transcription with random primers or M gene-specific primers

    • Design primers targeting M gene conserved regions

    • Implement absolute quantification using standard curves from in vitro transcribed RNA

    • Normalize to reference genes (e.g., GAPDH, β-actin)

  • Mass spectrometry approaches:

    • Perform targeted proteomics using selected reaction monitoring (SRM)

    • Utilize stable isotope-labeled peptide standards for absolute quantification

    • Target unique peptides from the M protein sequence

    • Apply data-dependent or data-independent acquisition methods

For viral isolate comparisons, researchers typically measure viral shedding by qRT-PCR targeting the N gene and can adapt similar approaches for M gene-specific quantification.

What experimental design is recommended for comparing M protein variants from different PRCV isolates?

When comparing M protein variants from different PRCV isolates, a comprehensive experimental design should include:

  • Sequence analysis workflow:

    • Perform multiple sequence alignment of M gene sequences from different isolates

    • Identify key amino acid substitutions and predict functional consequences

    • Generate phylogenetic trees to establish evolutionary relationships

    • Map mutations onto predicted structural models

  • Expression system standardization:

    • Express all variants in identical cellular backgrounds

    • Use consistent promoters and expression vectors

    • Verify equivalent expression levels before functional comparisons

    • Include tagged and untagged versions to assess tag interference

  • Functional characterization protocol:

    • Assess protein localization via immunofluorescence microscopy

    • Evaluate membrane topology using protease protection assays

    • Determine protein-protein interactions using co-immunoprecipitation

    • Measure virion incorporation efficiency

  • Comparative infection studies:

    • Generate recombinant viruses with M protein variants using reverse genetics

    • Measure replication kinetics in both cell culture and ex vivo systems

    • Determine viral shedding in experimental infections

    • Assess pathological outcomes in relation to M protein sequence

This methodological approach was successfully implemented when comparing traditional (1989) versus variant (2020) PRCV isolates, revealing that the 2020 variant demonstrated similar pathogenicity but enhanced transmissibility . Such experimental designs allow researchers to correlate M protein sequence changes with functional outcomes.

How do post-translational modifications of the PRCV M protein affect its function and detection methods?

Post-translational modifications (PTMs) of the PRCV M protein significantly impact both its biological function and detection methodologies:

  • Glycosylation analysis:

    • The PRCV M protein typically contains N-linked glycosylation sites in its N-terminal ectodomain

    • Methodology: Compare protein migration patterns before and after treatment with endoglycosidases (PNGase F, Endo H)

    • Functional impact: Glycosylation affects protein folding, stability, and potentially virion assembly

  • Phosphorylation assessment:

    • Methodology: Use phospho-specific antibodies or mass spectrometry with titanium dioxide enrichment

    • Analyze protein migration before and after phosphatase treatment

    • Functional impact: Phosphorylation may regulate protein-protein interactions and trafficking

  • Ubiquitination detection:

    • Methodology: Immunoprecipitate M protein and probe for ubiquitin or express HA-tagged ubiquitin

    • Functional impact: May regulate protein stability and turnover

  • Implications for detection methods:

    • Western blot: PTMs alter migration patterns and can affect antibody recognition

    • Mass spectrometry: Special enrichment techniques required for comprehensive PTM mapping

    • Antibody-based assays: Epitope accessibility may be affected by PTMs

  • Experimental considerations:

    • Cell type influences PTM patterns on recombinant proteins

    • Viral infection may alter host cell PTM machinery

    • Proper controls needed to distinguish M protein variants from differently modified forms

Researchers should verify that detection methods recognize all relevant forms of the M protein to avoid bias in experimental results. The ST cell line commonly used for PRCV propagation provides an appropriate cellular context for studying authentic M protein modifications.

What are the methodological considerations for studying M protein's role in immune evasion?

The PRCV M protein may contribute to viral immune evasion strategies, requiring specialized methodologies to investigate:

  • Innate immune signaling inhibition:

    • Methodology: Measure IFN-β promoter activity using luciferase reporter assays

    • Analyze phosphorylation status of key signaling molecules (IRF3, STAT1) by western blot

    • Assess cytokine production using ELISA or multiplex assays

    • Protocol: Compare signaling in cells expressing M protein versus controls following stimulation with PAMPs

  • Antigen presentation interference:

    • Methodology: Measure surface MHC-I levels by flow cytometry

    • Track intracellular MHC-I trafficking using confocal microscopy

    • Assess peptide loading complex function via co-immunoprecipitation

    • Protocol: Compare control cells versus M protein-expressing cells

  • Antibody epitope accessibility:

    • Methodology: Generate a panel of monoclonal antibodies against different M protein regions

    • Perform epitope mapping using peptide arrays or phage display

    • Compare antibody binding to native virions versus recombinant protein

    • Protocol: Assess whether M protein conformation in virions masks certain epitopes

  • Experimental models for immune response:

    • In vitro: Co-culture M protein-expressing cells with immune cells

    • Ex vivo: Utilize tracheal organ cultures to model tissue-level responses

    • In vivo: Compare immune responses to wild-type virus versus M protein variants in experimental infections

These methodological approaches should be integrated with systems that allow comparison between traditional and variant PRCV strains, as evolutionary changes may affect immune evasion capabilities .

What bioinformatic approaches are most effective for analyzing PRCV M protein evolution across isolates?

Effective bioinformatic analysis of PRCV M protein evolution requires a multifaceted approach:

  • Sequence collection and curation:

    • Systematically collect M protein sequences from different geographical regions and time periods

    • Verify sequence quality and remove partial or low-quality sequences

    • Annotate sequences with metadata (isolation date, location, host information)

    • Include related coronavirus M proteins (TGEV, SARS-CoV-2) as outgroups

  • Phylogenetic analysis protocol:

    • Perform multiple sequence alignment using MUSCLE or MAFFT algorithms

    • Select appropriate evolutionary models using ModelTest or similar tools

    • Construct phylogenetic trees using maximum likelihood (RAxML, IQ-TREE) or Bayesian approaches

    • Assess node support through bootstrap replication or posterior probabilities

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify sites under positive selection

    • Apply site-specific models (SLAC, FEL, MEME) to detect episodic selection

    • Implement branch-site models to detect lineage-specific selection

    • Methodology: Use PAML, HyPhy, or Datamonkey web server

  • Structural impact prediction:

    • Map sequence variations onto protein structure models

    • Predict effects on protein stability using FoldX or Rosetta

    • Identify potentially altered protein-protein interaction interfaces

    • Analyze changes in predicted post-translational modification sites

  • Recombination detection:

    • Apply methods such as RDP4, GARD, or 3SEQ

    • Identify potential breakpoints and parental sequences

    • Evaluate statistical significance of detected events

This comprehensive bioinformatic approach has revealed important evolutionary trends, such as the emergence of variant strains with enhanced transmissibility compared to traditional isolates , providing critical information for diagnostic test development and vaccine design.

How can researchers troubleshoot problems with recombinant PRCV M protein solubility and purification?

Recombinant coronavirus M proteins present significant solubility challenges due to their multiple transmembrane domains. Effective troubleshooting approaches include:

  • Solubility enhancement strategies:

    • Express fusion constructs with solubility tags (MBP, SUMO, TrxA)

    • Optimize detergent selection using systematic screening

    • Test detergent-to-protein ratios (typically 10:1 to 100:1)

    • Recommended detergents: LMNG, DDM, UDM, or GDN

    • Implement temperature reduction during expression (16-18°C)

  • Extraction protocol optimization:

    • Methodical testing of buffer conditions:

      • pH range: 7.0-8.5

      • Salt concentration: 150-500 mM NaCl

      • Glycerol content: 5-20%

    • Incorporate stabilizing additives (e.g., cholesterol hemisuccinate)

    • Use gentle membrane solubilization with extended extraction times (12-24h)

    • Consider native membrane extraction systems (SMALPs, nanodiscs)

  • Purification troubleshooting matrix:

    IssuePotential CauseSolution Approaches
    Low binding to affinity resinTag inaccessibilityReposition tag; use longer linkers
    Aggregation during purificationDetergent issuesTest detergent exchange; add lipids
    Co-purifying contaminantsNon-specific bindingIncrease imidazole in wash buffers; add secondary purification step
    Low yieldPoor expressionOptimize codon usage; test different cell lines
  • Quality control assessments:

    • Size exclusion chromatography to evaluate monodispersity

    • Circular dichroism to verify secondary structure

    • Intrinsic fluorescence to assess tertiary structure

    • Thermal shift assays to evaluate stability

When establishing purification protocols, researchers should consider the successful approaches used for membrane protein purification in coronavirus research, adapting methods for the specific characteristics of the PRCV M protein.

What strategies can researchers employ when experiencing cross-reactivity issues in PRCV M protein antibody development?

Cross-reactivity represents a significant challenge in PRCV-specific antibody development due to the high sequence homology between PRCV and TGEV M proteins. Effective troubleshooting strategies include:

  • Epitope selection methodology:

    • Perform detailed sequence alignment between PRCV and related coronavirus M proteins

    • Identify regions with maximal sequence divergence

    • Utilize epitope prediction algorithms to identify surface-exposed regions

    • Target unique post-translational modification sites when present

  • Antibody screening protocol enhancements:

    • Implement dual-screening against both PRCV and TGEV M proteins

    • Include counter-selection steps against related coronavirus proteins

    • Use competitive ELISA formats to identify differential binding

    • Test antibodies across multiple assay platforms (ELISA, western blot, IFA)

  • Cross-reactivity management strategies:

    • Develop sandwich ELISA formats using antibody pairs targeting different epitopes

    • Implement blocking steps with recombinant proteins from related viruses

    • Use absorption protocols to remove cross-reactive antibodies

    • Quantify cross-reactivity and establish correction factors for quantitative assays

  • Advanced antibody engineering approaches:

    • Apply affinity maturation techniques to increase specificity

    • Develop recombinant antibody formats with enhanced specificity

    • Consider single-domain antibody formats that may access unique epitopes

    • Implement negative design principles to reduce off-target binding

Research has demonstrated that commercial TGEV/PRCV serological kits exhibit significant cross-reactivity, especially during early infection stages, with cross-reactivity patterns varying depending on the viral strain . These observations highlight the importance of rigorous validation when developing M protein-specific antibodies.

How can the PRCV M protein serve as a model for studying human coronavirus membrane proteins?

The PRCV M protein offers valuable insights as a model system for human coronavirus research:

  • Comparative structural analysis:

    • PRCV M protein shares core structural features with human coronavirus M proteins

    • All coronavirus M proteins contain 3 transmembrane domains with similar topology

    • The C-terminal endodomain interacts with nucleocapsid proteins across coronavirus species

    • Methodology: Structure-function comparisons between PRCV and human coronavirus M proteins

  • Advantages of the PRCV model system:

    • Natural host (pigs) has similar respiratory physiology to humans

    • Established ex vivo models (tracheal organ cultures) allow study in physiologically relevant tissues

    • Biosafety considerations favorable compared to human pathogens

    • Experimental challenges in natural hosts are feasible and well-characterized

  • Translational research applications:

    • Testing broadly-reactive anti-M protein antivirals

    • Validating structural predictions for coronavirus M proteins

    • Evaluating M protein-directed vaccine strategies

    • Investigating M protein roles in pathogenesis across coronavirus species

  • Methodological framework for cross-species insights:

    • Identify conserved functional domains through comparative genomics

    • Perform complementation studies with chimeric M proteins

    • Test cross-species protein-protein interactions

    • Evaluate cross-reactivity of antibodies and antivirals

Research has demonstrated that pigs infected with PRCVs of differing pathogenicity provide valuable comparisons with human data from SARS-CoV-2 infection , highlighting the relevance of this model system for understanding human coronavirus biology.

What are the current limitations in PRCV M protein research and promising methodological approaches to overcome them?

Current PRCV M protein research faces several limitations that require innovative methodological approaches:

  • Structural characterization limitations:

    • Challenge: Membrane proteins resist conventional structural biology techniques

    • Promising approaches:

      • Apply cryo-electron microscopy to study M protein in intact virions

      • Implement advanced computational prediction tools (AlphaFold2)

      • Utilize hydrogen-deuterium exchange mass spectrometry to probe dynamics

      • Develop semi-synthetic approaches for segmental isotope labeling

  • Functional analysis constraints:

    • Challenge: Difficulty separating M protein functions from other viral components

    • Promising approaches:

      • Apply CRISPR-based genome editing to modify M genes in viral context

      • Develop split-protein complementation assays for interaction mapping

      • Implement optogenetic tools to control M protein activity

      • Create minimal systems reconstituting M protein functions

  • Evolutionary analysis limitations:

    • Challenge: Relatively few complete PRCV genome sequences available

    • Promising approaches:

      • Implement targeted sequencing of M genes from clinical samples

      • Apply deep sequencing to identify minor variants

      • Develop rapid genotyping assays for M gene mutations

      • Create repositories of contemporary isolates for phenotypic testing

  • Translation to vaccine development:

    • Challenge: M protein's limited surface exposure reduces antibody accessibility

    • Promising approaches:

      • Develop display platforms presenting critical M protein epitopes

      • Create chimeric antigens incorporating M protein conserved regions

      • Target T cell responses against conserved M protein epitopes

      • Implement structure-based design for M protein-targeted vaccines

Recent advancements, such as the successful isolation and characterization of variant PRCV from US pigs and the comparative analysis of traditional versus variant strains , demonstrate how innovative methodologies can overcome existing limitations and advance the field.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.