Recombinant Porcine respiratory coronavirus Non-structural protein 3b (3b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Advance notification is required for dry ice shipping, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
3b; Non-structural protein 3b; ns3b; Accessory protein 3b; Non-structural protein 3-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Porcine respiratory coronavirus (strain RM4) (PRCoV) (PRCV)
Target Names
3b
Target Protein Sequence
MIGGLFLNTLSFVIVSNHPIVNNTANVHHIQQERVIVQQHHVVSARTQNYYPEFSIAVLF VSFLALYRSTNFKTCVGILMFKILSMTLLGPMLIAYGYYIDGIVTTTVLSLRFAYLAYFW YVNSRFEFILYNTTTLMFVHGRAAPFKRSSHSSIYVTLYGGINYMFVNDLTLHFVDPMLV SIAIRGLAHADLTVVRAVELLNGDFIYVFSQEPVVGVYNAAFSQAVLNEIDLKEEEGDRT YDVS
Uniprot No.

Target Background

Protein Families
Coronaviruses NS3b protein family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is PRCV non-structural protein 3b and how does it differ from its TGEV counterpart?

PRCV non-structural protein 3b (3b) is a product of open reading frame 3 (ORF3) in the Porcine Respiratory Coronavirus genome. PRCV is a respiratory variant of Transmissible Gastroenteritis Virus (TGEV) that emerged in the early 1980s in Belgium. The key differences between PRCV 3b and TGEV 3b lie in their genetic structure and expression.

The ORF3 region in coronaviruses encodes accessory proteins that are not essential for viral replication but may contribute to virulence and tissue tropism. In PRCV strains, there is significant variability in the ORF3/3b gene region:

  • Some PRCV isolates (AR310 and LEPP) have an intact ORF3 gene preceded by a CTAAAC leader RNA-binding site, predicted to yield a protein of 72 amino acids, the same size as that of the virulent Miller strain of TGEV .

  • Other PRCV isolates show various deletions in the ORF3 region that affect the expression of the 3b protein .

  • The ORF3 gene of PRCV isolate IA1894 was found to yield a truncated protein of 54 amino acids due to a 23-nucleotide deletion .

  • In the PRCV isolate ISU-1, the CTAAAC leader RNA-binding site and ATG start codon of the ORF3 gene were removed because of a 168-nucleotide deletion .

These variations in the ORF3 region may influence the virulence and tissue tropism of different PRCV strains.

What is known about the functional role of non-structural protein 3b in PRCV pathogenesis?

The functional role of non-structural protein 3b in PRCV pathogenesis is not fully elucidated, but several studies provide insights:

Research on related coronaviruses suggests potential functions:

  • In SARS-CoV, the 3b protein has been shown to localize to the nucleus and nucleolus, suggesting a role in regulating host cell functions .

  • Coronavirus accessory proteins, including those encoded by ORF3, are often involved in antagonizing host immune responses .

How do PRCV strains vary in their expression of non-structural protein 3b?

PRCV strains exhibit significant variation in the expression of non-structural protein 3b due to different genetic structures in the ORF3 region:

PRCV StrainORF3/3b Gene StatusPredicted Protein ProductmRNA Production
AR310Intact ORF3 gene with CTAAAC leader RNA-binding site72 amino acid protein (full length)8 subgenomic mRNA species
LEPPIntact ORF3 gene with CTAAAC leader RNA-binding site72 amino acid protein (full length)8 subgenomic mRNA species
IA189423-nucleotide deletion in ORF3aTruncated protein of 54 amino acids7 subgenomic mRNA species
ISU-1168-nucleotide deletion removing CTAAAC leader and ATG start codonNo functional protein produced7 subgenomic mRNA species
RM4 (used for recombinant protein)Specific sequence documented244 amino acid proteinNot specified

These variations in 3b expression potentially contribute to differences in pathogenicity and tissue tropism among PRCV strains. The AR310 and LEPP strains were the first PRCV isolates found to have intact ORF3 genes, which may influence their biological properties compared to strains with deletions in this region .

What experimental techniques are recommended for expressing and purifying recombinant PRCV non-structural protein 3b?

For researchers working with recombinant PRCV non-structural protein 3b, the following methodological approaches are recommended:

Expression Systems:

  • Bacterial expression systems: E. coli-based systems using vectors like pGBKT7, pGADT7, pTriEx-flag, or pET series for His-tagged proteins .

  • Eukaryotic expression systems: For functional studies, mammalian expression vectors like pEGFP-N1 and pEGFP-C1 can be used to create fusion proteins with fluorescent tags for localization studies .

Purification Protocols:

  • Affinity chromatography:

    • His-tagged purification using nickel magnetic beads or Ni-NTA columns

    • GST-fusion protein purification using glutathione agarose

    • MBP-fusion protein purification using amylose resin

  • Protein preparation considerations:

    • For transmembrane domains, consider deletion of these regions to improve solubility

    • Storage in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage

    • Working aliquots can be stored at 4°C for up to one week

    • Avoid repeated freezing and thawing

Validation Methods:

  • Western blotting using tag antibodies or specific antibodies against PRCV 3b

  • SDS-PAGE with Coomassie brilliant blue staining

  • Mass spectrometry to confirm protein identity and integrity

What approaches can be used to study the subcellular localization of PRCV non-structural protein 3b?

Based on studies of related coronavirus 3b proteins, particularly SARS-CoV 3b, the following approaches are recommended for studying subcellular localization:

Fluorescence Microscopy Techniques:

  • Fusion protein expression: Create N- or C-terminal EGFP fusion constructs using vectors like pEGFP-N1 and pEGFP-C1. These can be transfected into cell lines relevant for PRCV research (e.g., ST cells, porcine alveolar macrophages) .

  • Co-localization studies: Use markers for specific cellular compartments:

    • Nucleolar proteins: C23, B23, fibrillarin (co-transfection with DsRed-tagged versions)

    • Nuclear membrane: Lamin B

    • Endomembrane system: Calnexin (ER), GM130 (Golgi)

  • Immunofluorescence assays: Use antibodies against PRCV 3b or epitope tags, combined with antibodies against cellular markers .

  • Bimolecular fluorescence complementation (BiFC): To study protein-protein interactions within specific cellular compartments .

Molecular Approaches:

  • Deletion and mutation analysis: Create truncated mutants to identify regions responsible for specific localization patterns. For instance, in SARS-CoV 3b, residues 134-154 were identified as responsible for nucleolar localization .

  • Bioinformatic prediction: Use tools like PSORT II server to identify potential nuclear localization signals (NLS) or nucleolar localization signals (NoLS) .

  • Cell fractionation: Separate nuclear, cytoplasmic, and membrane fractions biochemically, followed by Western blot analysis.

Cell Lines for Localization Studies:
Multiple cell lines should be tested as localization patterns may vary:

  • 293 cells

  • Vero cells

  • COS-7 cells

  • A549 cells

  • Porcine cell lines (ST cells, PK15)

  • Primary porcine cells (alveolar macrophages)

How can researchers investigate the interactions between PRCV non-structural protein 3b and host proteins?

To investigate interactions between PRCV non-structural protein 3b and host proteins, researchers can employ several complementary approaches:

Protein-Protein Interaction Methods:

  • Yeast Two-Hybrid (Y2H) Screening:

    • Clone the PRCV 3b gene into vectors like pGBKT7 (bait) and screen against a porcine cDNA library in pGADT7 (prey) .

    • For transmembrane domains, delete these regions to improve expression and avoid false negatives .

  • Pull-down Assays:

    • Express recombinant 3b with affinity tags (His, GST, Flag, MBP) .

    • Mix with cell lysates and capture using appropriate affinity resins.

    • Identify interacting proteins by mass spectrometry or Western blotting.

    • Example protocol: Express His-tagged 3b, mix with cell lysates, capture with nickel magnetic beads, elute with imidazole buffer (50 mM sodium phosphate, 300 mM NaCl, 300 mM imidazole, pH 8.0) .

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent proteins (e.g., YFP) are fused to 3b and potential interacting partners.

    • Reconstitution of fluorescence occurs only when proteins interact .

  • Co-immunoprecipitation:

    • Express tagged versions of 3b in relevant cell lines.

    • Immunoprecipitate with tag antibodies and identify co-precipitating proteins.

Functional Interaction Studies:

  • Reporter Assays:

    • For investigating effects on host gene expression (e.g., interferon response) .

    • Dual-luciferase reporter systems can quantify effects on specific pathways.

  • RNA Analysis:

    • RT-PCR and qPCR to measure changes in host gene expression in response to 3b expression .

    • RNA-seq to identify global transcriptome changes.

  • Protein Modification Analysis:

    • Phosphorylation state analysis to determine if 3b affects host protein phosphorylation.

    • Ubiquitination assays to assess effects on protein stability.

How does non-structural protein 3b potentially contribute to immune evasion in PRCV infection?

While specific data on PRCV non-structural protein 3b's role in immune evasion is limited, evidence from related coronaviruses suggests several potential mechanisms:

Potential Immune Evasion Mechanisms:

  • Interferon (IFN) Antagonism:

    • Studies have shown that PRCV infection induces higher levels of IFN-α than other coronaviruses like PRRSV, but the specific role of 3b in this response is not well characterized .

    • Non-structural proteins of coronaviruses often interfere with IFN production or signaling pathways. For example, in PRRSV, several NSPs have innate immune evasion properties .

  • Nuclear/Nucleolar Localization:

    • Based on studies of SARS-CoV 3b, which localizes to the nucleus and nucleolus, PRCV 3b may similarly disrupt host cell functions by interacting with nuclear components .

    • Nucleolar localization could potentially interfere with ribosome biogenesis, host cell translation, or other nucleolar functions essential for mounting an effective immune response.

  • RNA Sensing Evasion:

    • Coronavirus non-structural proteins like nsp15 have been shown to mediate evasion of dsRNA sensing by host pattern recognition receptors .

    • PRCV 3b might play a complementary role in this process, particularly given the variability of this protein across PRCV strains with different pathogenicity profiles.

  • Cell Death Modulation:

    • Some coronavirus proteins can modulate cell death pathways, shifting from apoptosis to other forms of cell death like necroptosis .

    • The presence or absence of functional 3b protein might influence these pathways in PRCV infection.

Experimental Evidence and Research Gaps:

  • PRCV infected animals develop antibody and T cell responses that cross-react with different PRCV strains and TGEV .

  • The comparison of immune responses between PRCV strains with intact versus deleted/truncated 3b proteins could provide insights into the role of this protein in immune evasion .

  • Further research is needed to directly link 3b expression with specific immune evasion mechanisms in PRCV infection.

How can PRCV and its non-structural protein 3b serve as a model for studying other respiratory coronaviruses?

PRCV provides a valuable model for studying respiratory coronaviruses, including emerging human pathogens like SARS-CoV-2, for several reasons:

Advantages of PRCV as a Coronavirus Model:

  • Natural Host System:

    • Pigs are a natural host for PRCV, eliminating concerns about artificial host adaptation seen in laboratory models .

    • Pigs have similar physiology and immunology to humans, making them relevant for translational research .

  • Pathogenesis Similarities:

    • PRCV causes respiratory disease that can vary from mild to severe pneumonia, similar to the spectrum of disease seen in human coronavirus infections .

    • Different PRCV strains produce varying degrees of lung pathology, providing a system to study determinants of coronavirus virulence .

  • Controlled Experimental Setting:

    • PRCV infection in pigs allows for controlled experimental conditions and sampling that would be impossible in human studies .

    • The time course of infection can be precisely tracked, from initial infection through viral clearance .

Role of Non-structural Protein 3b in Comparative Studies:

  • Genetic Variability:

    • The natural variation in 3b protein across PRCV strains provides an opportunity to correlate genetic differences with pathogenicity .

    • Chimeric viruses or recombinant systems can be used to specifically evaluate the contribution of 3b to viral phenotypes.

  • Comparative Analysis with Other Coronavirus 3b Proteins:

    • Structural and functional studies of PRCV 3b can be compared with homologous proteins from SARS-CoV, MERS-CoV, and SARS-CoV-2 .

    • Such comparisons may reveal conserved mechanisms of viral pathogenesis and immune evasion.

  • Model for Coronavirus Evolution:

    • PRCV emerged from TGEV through natural deletion events, including modifications in the ORF3 region .

    • This evolutionary relationship provides insights into how coronaviruses adapt to new tissues and hosts through genetic changes.

Practical Applications:

  • Testing Therapeutic Interventions:

    • The PRCV pig model has been used to evaluate treatments like dexamethasone for coronavirus-induced pneumonia .

    • Similar approaches could be applied to test antivirals targeting non-structural proteins.

  • Vaccine Development Strategies:

    • Understanding the role of accessory proteins like 3b in immunity could inform vaccine design strategies for coronaviruses .

    • Cross-reactive immune responses between PRCV strains and TGEV demonstrate principles relevant to coronavirus vaccine development .

What cutting-edge research techniques can be applied to further understand the structure-function relationship of PRCV non-structural protein 3b?

To advance our understanding of PRCV non-structural protein 3b, researchers can apply several cutting-edge techniques:

Structural Biology Approaches:

  • X-ray Crystallography:

    • Determine high-resolution crystal structures of PRCV 3b, similar to the 1.77-Å resolution structure obtained for SARS-CoV-2 nsp1 .

    • Compare structures across different PRCV strains to identify critical structural features related to function.

  • Cryo-Electron Microscopy (Cryo-EM):

    • Visualize 3b protein in complex with interacting partners or in membrane environments.

    • Study conformational changes upon binding to nucleic acids or host proteins.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Characterize dynamic properties and solution structure of 3b.

    • Identify regions involved in protein-protein interactions.

Advanced Genetic Approaches:

  • CRISPR-Cas9 Genome Editing:

    • Create cell lines or potentially pigs with modified host factors that interact with 3b.

    • Introduce specific mutations in the PRCV genome to alter 3b structure or expression.

  • Reverse Genetics Systems:

    • Develop infectious clones of PRCV with modifications in the 3b gene to test functional hypotheses.

    • Create chimeric viruses exchanging 3b regions between strains with different pathogenicity.

Systems Biology and Omics Approaches:

  • Proteomics:

    • Proximity labeling techniques (BioID, APEX) to identify proteins in close proximity to 3b in different cellular compartments.

    • Quantitative proteomics to measure global protein changes in response to 3b expression.

  • Transcriptomics:

    • RNA-seq analysis comparing host responses to PRCV strains with intact versus deleted 3b genes.

    • Single-cell RNA-seq to characterize cell type-specific responses to 3b expression.

  • Interactomics:

    • Systematic analysis of the PRCV 3b interactome using high-throughput techniques.

    • Creation of protein-protein interaction networks to place 3b in cellular pathways.

Advanced Microscopy Techniques:

  • Super-resolution Microscopy:

    • Techniques like STORM, PALM, or STED for nanoscale visualization of 3b localization and dynamics.

    • Multi-color imaging to track co-localization with host factors at the nanoscale.

  • Live-cell Imaging:

    • Real-time visualization of 3b trafficking in infected cells.

    • FRAP (Fluorescence Recovery After Photobleaching) to measure protein mobility.

Computational and AI Approaches:

  • Molecular Dynamics Simulations:

    • Model the dynamic behavior of 3b in different cellular environments.

    • Predict effects of mutations on protein stability and function.

  • Machine Learning Prediction:

    • Predict potential interaction partners or functional effects based on sequence features.

    • Identify patterns in experimental data that correlate with pathogenicity.

By combining these advanced techniques, researchers can develop a comprehensive understanding of the structure-function relationship of PRCV non-structural protein 3b and its role in viral pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.