Recombinant Porcine torovirus Hemagglutinin-esterase (HE)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Porcine Torovirus Hemagglutinin-esterase (HE)

Recombinant Porcine Torovirus Hemagglutinin-esterase (HE) is a viral envelope protein found in toroviruses, coronaviruses, and orthomyxoviruses, all of which are associated with enteric or respiratory infections . Hemagglutinin-esterases mediate reversible binding to sialic acid receptor determinants, which are abundant glycan residues in the enteric and respiratory tracts . The hemagglutination caused by HE proteins results from the binding of their lectin or receptor-binding domain to specific sialic acid determinants on the surface of red blood cells (RBCs) .

Structure and Function of Hemagglutinin-esterase (HE)

Hemagglutinin esterase (HEs) is a glycoprotein used by certain enveloped viruses as an invading mechanism . HEs facilitates the attachment and destruction of specific sialic acid receptors found on the host cell surface . The different HE enzyme activities include receptor binding activity, receptor hydrolysis (esterase) activity, and membrane fusion activity . HEs is a dimer transmembrane protein consisting of two monomers, with each monomer comprising three domains: a membrane fusion domain, an esterase domain, and a receptor-binding domain .

  • Receptor Binding Activity The receptor binding activity involves the attachment of HEs to N-acetyl-9-O-acetylneuraminic acid (9-O-Ac- Neu5Ac) of glycolipids and glycoproteins, which then serve as viral receptors .

  • Receptor Hydrolysis (Esterase) Activity Receptor hydrolysis activity allows virus particles to escape the infected cell by removing an acetyl group from the C9 position of terminal 9-O-Ac-Neu5Ac residues .

  • Membrane Fusion Activity Membrane fusion activity enhances the attachment between the viral envelope and the host cell membrane, helping incorporate the viral genome into the host cell cytoplasm .

Genetic Characteristics and Evolution

Phylogenetic analysis of HE coding sequences from porcine torovirus (PToV) field strains has revealed the existence of two distinct HE lineages . Studies suggest that the specificity of the immune response towards one or the other HE lineage in piglets at a given time could determine the PToV strain that prevails and spreads . The tendency to recombine modules of their genomes, along with extensive mutation rates, facilitates the evasion of immune responses and rapid adaptation to new hosts and environments .

Antigenic Differences Between HE Lineages

Significant antigenic differences exist between the two HE lineages of PToV . These differences were confirmed through HI assays and ELISA, demonstrating that serum samples from piglets displayed varying antibody response dynamics against HE proteins from different lineages . The specificity of the piglet’s immune response, whether its own or maternal, towards one or the other HE lineage at a given time, could determine the PToV strain that infects or prevails in the animal .

Role in Virus-Host Interactions

The PToV-HE protein plays a crucial role in virus-host interactions, influencing immune protection and potentially explaining the broad spread of this virus in the pig population, causing chronic infections/re-infections of the animals . The persistence of the HE protein in field strains, its tendency to undergo recombination events, and the different antigenic characteristics of both HE lineages highlight its importance in these interactions .

Research Findings on Antibody Response

Longitudinal studies on piglet serum samples revealed distinct antibody response dynamics against different HE lineages . For instance, anti-HE52.7 antibodies were detected early in some piglets, while others showed reactivity against HE52.11 . The study also found that the shift from PToV-HE52.7 to PToV-HE52.11 in the analyzed animals might derive from immune pressure .

Tables Summarizing Key Data

The following tables summarize key data regarding the antibody responses to different PToV-HE lineages:

Table 1: Antibody Response Dynamics Against HE52.7 and HE52.11

Week% of Piglets Reactive Against HE52.7% of Piglets Reactive Against HE52.11
165%Variable (litter-dependent)
7ConstantRemains Constant
1125%20%
1533%67%

Table 2: Comparison of ELISA Reactivities and HI Titers

LitterEarly Weeks15 Weeks Old
A & BHigher reactivity against HE52.11Preferentially react against HE52.11
CHigher titers against HE52.7React preferentially against HE52.11

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your use.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
HE; Hemagglutinin-esterase; HE protein; E3 glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-430
Protein Length
Full Length of Mature Protein
Species
Porcine torovirus (strain P10) (PoTV)
Target Names
HE
Target Protein Sequence
KPITPHYGPGHITSDWCGFGDSRSDCGNQHTPKSLDIPQELCPKFSSRTGSSMFISMHWN NDSDFNAFGYSNCGVEKVFYEGVNFSPYRNYTCYQEGSFGWVSNKVGFYSKLYSMASTSR CIKLINLDPPTNFTNYRNGTCTGNGGTAKMPDNPQLVIFNSVVKVSTQFVLPSSSDGFSC TKHLVPFCYIDGGCFEMSGVCYPFGYYYQSPSFYHAFYTNGTAGLHRYICDYLEMKPGVY NATTFGKFLIYPTKSYCMDTMNYTVPVQAVQSIWSENRQSDDAIGQACKSPYCIFYNKTK PYLAPNGADENHGDEEVRQMMQGLLVNSSCVSPQGSTPLALYSSEMIYTPNYGSCPQYYK LFETSSDENVDVTSSAYFVATWVLLVLVIILIFILISFCLSSY
Uniprot No.

Target Background

Function

Recombinant Porcine torovirus Hemagglutinin-esterase (HE) is a structural protein forming short surface spikes on the virus. It exhibits receptor-binding and receptor-destroying activities, mediating the de-O-acetylation of N-acetyl-9-O-acetylneuraminic acid, a likely receptor determinant recognized by the virus on erythrocyte and susceptible cell surfaces. This receptor-destroying activity is crucial for viral release, preventing self-aggregation and ensuring efficient cell-to-cell spread of progeny virions. HE may function as a secondary viral attachment protein, initiating infection alongside the primary spike protein. While not strictly essential for viral infection in culture, its presence can influence pathogenicity. HE is a potential target for both humoral and cellular immune responses.

Protein Families
Influenza type C/coronaviruses hemagglutinin-esterase family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.

Q&A

What is Porcine Torovirus Hemagglutinin-Esterase (HE)?

Porcine torovirus hemagglutinin-esterase (PToV-HE) is a viral envelope glycoprotein that mediates reversible attachment to O-acetylated sialic acids. The protein plays a dual functional role in the viral infection cycle by facilitating both viral attachment to host cell receptors (hemagglutinin activity) and viral release (esterase activity). PToV-HE forms homodimers and belongs to a family of related proteins found in toroviruses, coronaviruses, and influenza C viruses .

The protein contains both a receptor-binding domain (lectin domain) that recognizes specific sialic acid determinants and an esterase domain that functions as a receptor-destroying enzyme (RDE). This functional organization differs from influenza A and B viruses where these activities are performed by separate proteins .

How does PToV-HE compare structurally to other viral HE proteins?

The esterase domains of PToV-HE are highly similar to those of influenza C virus hemagglutinin-esterase-fusion protein (HEF) and bovine coronavirus HE, but ToV HEs possess unique functional receptor-binding sites. This structural conservation amid functional specialization provides insights into the evolution of these viral proteins across different virus families .

What expression systems are recommended for producing recombinant PToV-HE?

For efficient production of recombinant PToV-HE proteins, baculovirus expression systems have been successfully employed. The methodology involves:

  • PCR amplification of the HE gene from viral isolates, excluding the transmembrane and cytoplasmic regions (amino acids 354-392) while retaining the native signal peptide (amino acids 1-16)

  • Cloning into appropriate vectors (e.g., pCR®2.1-TOPO), followed by subcloning into baculovirus transfer plasmids (e.g., pBACgus-1)

  • Transformation into bacterial hosts for plasmid amplification

  • Transfection into insect cells for protein expression

This approach produces secretory forms of the protein that retain their functional properties while being easier to purify than membrane-bound forms. PCR cycling conditions typically used are: 95°C/2 min, followed by 35 cycles of 95°C/1 min, 63°C/1 min and 72°C/2 min, with a final extension step at 72°C/10 min .

How can the functionality of recombinant PToV-HE be verified?

Verification of recombinant PToV-HE functionality requires assessment of both its receptor-binding (hemagglutinin) and receptor-destroying (esterase) activities. Methodologies include:

  • Hemagglutination assay: Measures the ability of the protein to agglutinate red blood cells (RBCs), confirming receptor-binding function

  • Esterase activity assay: Quantifies the enzymatic activity using appropriate substrates

  • Immunostaining: Confirms protein expression and proper folding using monoclonal antibodies directed against PToV-HE

  • Hemagglutination inhibition (HI) assay: Tests whether antibodies can block the hemagglutination activity, useful for confirming antigenic properties

For immunostaining, protocols typically involve incubating protein-coated beads with specific monoclonal antibodies (e.g., 3H6F8/10C9F5 antibodies at 1:100 dilution), followed by detection with fluorescently labeled secondary antibodies (e.g., Alexa405® goat anti-mouse IgG at 2 μg/ml) .

What modifications can enhance recombinant PToV-HE purification and detection?

Several modifications can be incorporated into recombinant PToV-HE constructs to facilitate purification and detection:

  • Affinity tags: Addition of tags such as myc, His, or GST to either N- or C-terminus

  • Truncation: Removal of transmembrane and cytoplasmic domains (amino acids 354-392) while maintaining the signal peptide (amino acids 1-16) for secretion

  • Codon optimization: Adaptation of the coding sequence for optimal expression in the chosen host system

  • Signal sequence modifications: Enhancement or replacement of the native signal peptide to improve secretion efficiency

These modifications should be carefully designed to minimize interference with protein folding and function. Researchers should validate that modified recombinant proteins retain native-like activity through functional assays before proceeding with experimental applications.

How can site-directed mutagenesis be applied to study PToV-HE structure-function relationships?

Site-directed mutagenesis provides a powerful approach for investigating the structure-function relationships of PToV-HE. Key applications include:

  • Catalytic site analysis: Mutation of the serine residue (Ser32) in the enzymatic catalytic site to alanine (Ala32) completely abolishes esterase activity while preserving or even enhancing receptor binding. This confirms the essential role of serine in the enzyme's catalytic mechanism .

  • Receptor-binding domain investigation: Targeted mutations in the putative receptor-binding domain can help map the amino acids critical for hemagglutinin activity. This approach has revealed that specific amino acid differences between high and low virulent variants may localize to this domain .

  • Lineage-specific determinants: Strategic mutations can help identify residues responsible for the antigenic differences observed between different PToV-HE lineages, providing insights into viral evolution and immune evasion .

For optimal results, researchers should use crystal structure information to guide mutation design, focusing on conserved residues in functionally important domains and comparing effects across different PToV-HE variants.

What are the implications of PToV-HE lineage diversity in immunological studies?

Phylogenetic analysis has revealed the existence of at least two distinct PToV-HE lineages with significant antigenic differences. This diversity has important implications for immunological research:

  • Cross-reactivity: Antibodies raised against one PToV-HE lineage may show limited cross-reactivity with the other lineage, necessitating lineage-specific reagents for comprehensive detection

  • Coinfection dynamics: The coexistence of viruses with different HE lineages within the same pig herd, and even within the same animal at different time points, suggests complex infection dynamics that may impact immunity and viral persistence

  • Vaccine development: Effective vaccine strategies may need to incorporate antigens from multiple PToV-HE lineages to provide broad protection

Hemagglutination inhibition (HI) assays with sera from naturally infected pigs have demonstrated different antibody response dynamics against the two PToV-HE lineages. For example, in one study, 65% of piglets had antibodies against one lineage (HE52.7) at week 1, while reactivity to the other lineage (HE52.11) was initially limited and showed different temporal patterns across litters .

What methodologies are available for detecting antigenic differences between PToV-HE lineages?

Several complementary methodologies can be employed to investigate antigenic differences between PToV-HE lineages:

Enzyme-Linked Immunosorbent Assay (ELISA)

An indirect ELISA can be established using purified recombinant HE proteins from different lineages as coating antigens. The protocol typically involves:

  • Coating plates with purified HE proteins (e.g., HE52.7-myc and HE52.11-myc at 1.25 μg/mL)

  • Blocking with PBST-3% BSA

  • Incubating with serum samples (diluted 1:100)

  • Detecting bound antibodies with HRP-conjugated anti-pig IgG

  • Developing with OPD substrate and measuring absorbance at 492 nm

The ELISA cut-off should be established for each antigen as the mean of negative control serum O.D. plus three times the standard deviation .

Hemagglutination Inhibition (HI) Assay

HI assays detect antibodies that specifically block the receptor-binding domain:

  • DFP (diisopropyl fluorophosphate) inactivation of HE proteins to eliminate esterase activity

  • Titration of sera against standardized amounts of HE proteins

  • Addition of red blood cells to detect inhibition of hemagglutination

  • Calculation of HI titers based on the highest serum dilution preventing hemagglutination

This method specifically detects antibodies against the receptor-binding domain and can reveal lineage-specific immune responses .

Immunofluorescence and Immunostaining

Differential staining patterns can be observed when testing antibodies against cells expressing different PToV-HE lineages:

  • Expressing recombinant HE proteins on cell surfaces or coupling to beads

  • Incubating with test sera or monoclonal antibodies

  • Detecting bound antibodies with fluorescently labeled secondary antibodies

  • Analyzing staining patterns by fluorescence microscopy

What structural differences exist between PToV-HE lineages?

Crystal structures have revealed important differences between PToV-HE lineages. While both lineages form similar homodimers, they exhibit distinct features in their receptor-binding domains and esterase domains:

  • Receptor-binding domain differences influence specificity for different sialic acid modifications and presentations

  • Esterase domain variations affect substrate preferences, with some PToV HEs showing strong preference for 9-mono-O-acetylated sialic acids while others can cleave both 7,9-di-O- and 9-mono-O-acetylated sialic acids

  • Amino acid substitutions in the interface between domains may affect the relative orientation and functional coordination between binding and enzymatic activities

These structural differences likely evolved in response to differences in host cell receptor distribution or as immune evasion mechanisms. Understanding these variations is essential for designing broadly effective diagnostic tools and potential antiviral strategies.

How do antibody responses to different PToV-HE lineages evolve during infection?

Longitudinal studies of antibody responses in naturally infected pigs have revealed complex dynamics in the recognition of different PToV-HE lineages:

  • Early responses (Week 1):

    • 65% of piglets show antibodies against HE52.7 lineage

    • Reactivity to HE52.11 lineage is more limited and varies between litters

  • Post-weaning decline (Week 3):

    • HI titers decrease in most positive piglets

    • Percentage of positive animals remains relatively constant

  • Mid-term dynamics (Weeks 7-11):

    • At week 11, only 25% of piglets maintain reactivity against HE52.7

    • Only 20% show anti-HE52.11 antibodies

  • Late response (Week 15):

    • 67% of piglets develop positivity against HE52.11

    • 33% show reactivity against HE52.7, but with lower titers than against HE52.11

These patterns suggest sequential exposure to different viral variants and potential immune-driven selection pressures. The maternal antibody influence and subsequent infection dynamics create complex serological profiles that must be considered when designing diagnostic approaches.

What are the effects of specific mutations on PToV-HE function?

Research on recombinant PToV-HE proteins with targeted mutations has provided valuable insights into structure-function relationships:

MutationDomainFunctional EffectMechanistic Implication
Ser32AlaEsterase catalytic siteComplete abolition of enzymatic activity with preserved or enhanced receptor bindingConfirms Ser32 as an essential catalytic residue in the esterase active site
Amino acid differences between high and low virulent variantsReceptor-binding domain (2 residues)No significant impact on receptor-binding or release activitiesThese specific residues are not critical determinants of binding specificity
Amino acid difference between high and low virulent variantsEsterase domain (1 residue)No significant impact on enzymatic activityThis specific residue is not critical for catalytic function

These findings demonstrate that while some amino acid positions are absolutely critical for function (like Ser32 in the catalytic site), others may be more tolerant to substitutions. This information is valuable for understanding the molecular basis of PToV-HE activity and for designing targeted interventions .

How might advanced structural studies enhance our understanding of PToV-HE function?

Although crystal structures of PToV-HE have been determined, several advanced structural approaches could provide further insights:

  • Cryo-electron microscopy (cryo-EM) of PToV-HE in complex with whole virions to understand its arrangement and interactions in the native viral context

  • Molecular dynamics simulations to investigate the conformational flexibility of PToV-HE and how it might influence receptor binding and enzymatic activity

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe the dynamics of different PToV-HE domains and how they respond to receptor binding

  • Single-molecule studies to examine the kinetics of PToV-HE interactions with receptors and substrates at the individual molecule level

These approaches would complement existing crystallographic data and provide a more complete understanding of how PToV-HE functions in the context of viral infection.

What role might PToV-HE play in cross-species transmission?

Understanding the potential for cross-species transmission is an important area for future research:

  • Comparative studies of PToV-HE binding to sialic acid receptors from different host species could reveal potential barriers or facilitators of cross-species jumps

  • Investigation of PToV-HE evolution in different host environments might identify adaptations that enable broader host range

  • Analysis of antigenic differences between PToV-HE lineages could help predict the immunological consequences of cross-species transmission events

  • Development of reverse genetics systems to test how specific PToV-HE mutations affect viral tropism and host range would provide valuable experimental evidence

This research direction has significant implications for understanding the epidemiology and ecology of torovirus infections across different animal populations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.