Recombinant Porcine transmissible gastroenteritis coronavirus Membrane protein (M)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
M; 5; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-262
Protein Length
Full Length of Mature Protein
Species
Porcine transmissible gastroenteritis coronavirus (strain FS772/70) (TGEV)
Target Names
M
Target Protein Sequence
RYCAMKDDTGLSCRNSTASACESCFNGGDLIWHLANWNFSWSIILIIFITVLQYGRPQFS WFVYGIKMLIMWLLWPIVLALTIFNAYSEYQVSRYVMFGVSIAGAIVTFVLWIMYFVRSI QLYRRTKSWWSFNPEINAILCVSALGRSYVLPLEGVPTGVTLTLLSGNLYAEGFKIAGGM NIDNLPKYVMVALPSRTIVYTLVGKKLKASSATGWAYYVKSKAGDYSTDARTDNLSEQEK LLHMV
Uniprot No.

Target Background

Function
A component of the viral envelope crucial for virus morphogenesis and assembly through interactions with other viral proteins.
Protein Families
Alphacoronaviruses M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of TGEV M protein?

The TGEV M protein exists in multiple glycosylation states, primarily presenting as unglycosylated (M0) and glycosylated forms with low (M1) and high (M2) glycosylation levels . The protein has a molecular weight of approximately 28 kDa in its unglycosylated form, with the glycosylated forms having higher molecular weights . Mass spectrometry analysis has identified several peptide fragments from the M protein, including the C-terminal peptide TDNLSEQEKLLHMV with an m/z of 1,656.8 . The protein contains both hydrophobic transmembrane regions and hydrophilic domains that interact with other viral components.

How can researchers distinguish between different glycoforms of the TGEV M protein?

Researchers can distinguish between different glycoforms of the TGEV M protein using glycosidase treatment followed by SDS-PAGE and Western blot analysis. Treatment with N-Glycosidase F reduces all M protein bands to 28 kDa, confirming that the different forms correspond to different degrees of N-glycosylation . Interestingly, endoglycosidase H treatment produces two distinct protein bands: a major one corresponding to unglycosylated M protein and another corresponding to highly glycosylated M protein that is resistant to endoglycosidase H treatment . This resistance persists under both denaturing (in 1% SDS) and non-denaturing conditions, and is not affected by prolonged incubation or higher concentrations of the enzyme .

Which regions of the TGEV M protein are exposed on the virion surface?

The exposure of M protein domains on the virion surface can be determined through antibody binding experiments. Research has demonstrated that both the amino terminus and carboxy terminus of the M protein are exposed on the virion surface, as evidenced by the binding of specific monoclonal antibodies (MAbs) . MAb 25.22, specific for the amino terminus, and MAbs 9D.B4 and 3D.E3, specific for different peptides of the carboxy terminus, all bind directly to exposed epitopes on intact virions . This topological arrangement provides important insights into the structural organization of the M protein within the viral envelope.

How does the M protein composition differ between intact TGEV virions and virus cores?

The M protein composition differs significantly between intact virions and virus cores, particularly regarding the accessibility of the carboxy terminus. When virus cores are purified from intact virions with surface-bound M-specific antibodies, the MAbs directed against the carboxy terminus (9D.B4 and 3D.E3) are lost during the purification process . In contrast, MAb 25.22, which targets the amino terminus, remains bound to the cores . This differential retention suggests that the carboxy-terminal domain of M protein is primarily associated with the virion envelope and may be involved in interactions with other envelope components, while the amino terminus maintains connections with internal viral structures.

What methodologies are most effective for studying M protein topology in intact virions?

The most effective methodologies for studying M protein topology in intact virions combine proteolytic digestion, immunological detection, and mass spectrometry analysis. Researchers have successfully employed trypsin treatment of intact virions, with or without detergent (NP-40), followed by mass spectrometry to identify exposed peptides . The peptide with m/z 1,656.8, corresponding to the M protein C-terminus (TDNLSEQEKLLHMV), was released from intact virions by trypsin treatment, confirming its external exposure . Additionally, direct antibody binding assays using M-specific MAbs, coupled with Western blotting detection of bound immunoglobulin chains, provide complementary evidence for domain exposure . These approaches offer powerful tools for mapping protein topology within complex viral structures.

How do recombinant expression systems affect the glycosylation pattern of TGEV M protein?

Recombinant expression systems can significantly impact the glycosylation patterns of TGEV M protein, which is critical for researchers developing vaccine candidates or studying protein function. When expressed in recombinant systems, particularly those using adenoviral vectors, the glycosylation of M protein may differ from native virions due to cell-type specific glycosylation machinery . Researchers must carefully evaluate these post-translational modifications, as they can affect protein folding, antigenicity, and immunogenicity. Techniques such as endoglycosidase H and N-glycosidase F treatment, coupled with Western blot analysis, are essential for characterizing glycosylation patterns in recombinant systems . Comparative analysis between native and recombinant proteins can reveal important differences that may impact vaccine efficacy or diagnostic applications.

What are the optimal conditions for purifying recombinant TGEV M protein while maintaining its native conformation?

The purification of recombinant TGEV M protein while preserving its native conformation requires careful optimization of expression systems, detergents, and buffer conditions. For membrane proteins like TGEV M, expression in mammalian cell lines (such as PK15 or ST cells) often yields protein with more authentic folding and post-translational modifications compared to bacterial systems . Purification protocols typically involve gentle cell lysis with non-ionic detergents (such as NP-40), followed by immunoaffinity chromatography using M-specific antibodies . Buffer conditions must be optimized to maintain the protein's structural integrity, typically incorporating stabilizing agents like glycerol and avoiding harsh denaturants. Researchers should verify protein conformation using circular dichroism spectroscopy or conformation-specific antibodies to ensure that purified protein retains its native structure.

How can researchers effectively incorporate TGEV M protein into recombinant vaccine designs?

Incorporating TGEV M protein into recombinant vaccine designs requires strategic approaches to enhance immunogenicity while maintaining stability. One effective strategy involves creating chimeric constructs that combine the TGEV M protein with immunogenic components from other viruses, as demonstrated in recombinant adenovirus systems . When designing such vaccines, researchers should consider: (1) The expression vector system, with porcine adenovirus serotype 5 showing promising results for oral delivery ; (2) The insertion site within the vector, with the E3 region being suitable for accommodating foreign genes without compromising virus replication ; (3) The orientation of the inserted gene, as expression levels are significantly affected by orientation (left to right orientation shows better expression) ; and (4) The inclusion of appropriate targeting signals to ensure correct cellular localization of the expressed protein. Evaluation of vaccine candidates should include assessment of both systemic and mucosal immune responses, particularly secretory IgA in the intestine, which is crucial for protection against enteric coronaviruses .

How should researchers interpret mass spectrometry data for TGEV M protein peptides?

Interpreting mass spectrometry data for TGEV M protein requires careful analysis of peptide fragmentation patterns and mass-to-charge ratios (m/z). The table below shows key peptides identified from the M protein with their respective m/z values:

M Protein Peptidem/z (mean ± SD)
SIQLYRR935.2 ± 0.575
SDTDLSCR953.07 ± 0.595
AGDSTEAR969.09 ± 0.583
TIVYTLVGK993.26 ± 0.577
YVMVALPSR1,035.23 ± 0.583
AILCVSALGR1,059.27 ± 0.589
TIVYTLVGKK1,121.35 ± 0.571
IAGGMNIDNLPK1,242.31 ± 0.583
SWWSFNPETK1,281.25 ± 0.583
ASSATGWAYYVK1,302.95 ± 0.577
TKSWWSFNPETK1,510.39 ± 0.571
TDNLSEQEKLLHMV1,656.81 ± 0.015
SWWSFNPETKAILCVSALGP2,321.83 ± 0.577
SYVLPLEGVPTGVTLTLLSGNLYAEGFK2,938.21 ± 0.554

When analyzing such data, researchers should consider: (1) The precision of mass measurements, with low standard deviation (SD) values indicating high confidence in peptide identification; (2) The coverage of the protein sequence, with comprehensive coverage allowing more reliable structural predictions; (3) The presence of post-translational modifications, which may cause mass shifts from theoretical values; and (4) The reproducibility across independent experiments . The C-terminal peptide TDNLSEQEKLLHMV, with an m/z of 1,656.81 ± 0.015, shows particularly high precision in measurement, suggesting it serves as a reliable marker for M protein identification .

What statistical approaches are appropriate for analyzing antibody binding patterns to TGEV M protein epitopes?

When analyzing antibody binding patterns to TGEV M protein epitopes, researchers should employ multiple statistical approaches to ensure robust interpretation. For binding assays using monoclonal antibodies (MAbs) such as 25.22 (specific for the amino terminus) and 9D.B4 and 3D.E3 (specific for the carboxy terminus), quantitative analysis should include: (1) Normalization of binding signals against appropriate controls (such as non-specific MAbs like 3D.C10); (2) Comparison of binding patterns between intact virions and detergent-disrupted particles to distinguish surface-exposed epitopes from internal ones ; (3) Analysis of variance (ANOVA) to assess significance of binding differences between different MAbs and conditions; and (4) Correlation analysis between antibody binding and functional assays (such as virus neutralization) to establish biological relevance of the detected epitopes. For complex datasets involving multiple antibodies and conditions, multivariate analysis approaches, such as principal component analysis, can help identify patterns that might not be apparent through univariate statistics.

How can researchers overcome challenges in expressing recombinant TGEV M protein with authentic glycosylation patterns?

Achieving authentic glycosylation patterns in recombinant TGEV M protein expression presents significant challenges. Researchers can overcome these obstacles through several strategies: (1) Select appropriate expression systems – mammalian cell lines of porcine origin (such as PK15 used for TGEV isolation) may provide glycosylation machinery more similar to the natural host ; (2) Optimize culture conditions – supplementation with specific glycosylation precursors can enhance desired modifications; (3) Engineer the expression construct to include native signal sequences that direct proper protein trafficking through the secretory pathway; and (4) Implement glycoengineering approaches, such as co-expression with specific glycosyltransferases. To validate glycosylation patterns, comparative analysis between recombinant and virion-derived M protein should be performed using both endoglycosidase H and N-glycosidase F treatments followed by Western blotting or mass spectrometry . The presence of endoglycosidase H-resistant forms indicates complex glycosylation typical of proteins that have traversed the Golgi apparatus, which is an important quality attribute for vaccines or diagnostic reagents.

What are the critical considerations when designing monoclonal antibodies against different domains of TGEV M protein?

Designing effective monoclonal antibodies against different domains of TGEV M protein requires careful consideration of several factors: (1) Epitope selection – prioritize regions with high antigenicity and conservation across TGEV strains, such as the carboxy-terminal domain containing the TDNLSEQEKLLHMV peptide ; (2) Immunization strategy – use both synthetic peptides and recombinant protein fragments to generate antibodies against linear and conformational epitopes; (3) Screening methodology – implement a multi-stage screening process that evaluates binding to both recombinant protein and intact virions to identify antibodies recognizing native conformations; and (4) Characterization of epitope accessibility – compare antibody binding to intact virions versus detergent-disrupted particles to distinguish surface-exposed from internal epitopes . Additionally, researchers should evaluate cross-reactivity with related coronaviruses, such as porcine epidemic diarrhea virus (PEDV), to understand epitope conservation and potential for broad-spectrum applications . Establishing a panel of well-characterized domain-specific antibodies facilitates detailed structural studies and development of serological assays with enhanced specificity.

How does the TGEV M protein contribute to protective immunity in recombinant vaccine formulations?

The TGEV M protein plays multifaceted roles in generating protective immunity in recombinant vaccine formulations. Unlike the spike (S) protein, which is the primary target of neutralizing antibodies, the M protein contributes to protection through: (1) Induction of cross-reactive cellular immune responses that may provide broader protection against variant strains; (2) Stimulation of mucosal immunity when delivered via appropriate vectors like recombinant porcine adenovirus serotype 5 ; (3) Enhancement of vaccine stability due to its relatively conserved nature compared to the more variable S protein; and (4) Potential adjuvant effects through activation of innate immune receptors. In animal studies, recombinant adenoviruses expressing viral antigens have demonstrated the ability to induce virus-specific secretory IgA in both the small intestine and lungs following oral immunization, suggesting effective mucosal immunity . Furthermore, vaccines incorporating M protein alongside other viral components may provide more comprehensive protection than single-antigen formulations, particularly against enteric coronavirus infections where mucosal immunity is critical for protection.

What are the comparative advantages of different viral vectors for expressing TGEV M protein in vaccine applications?

Different viral vectors offer distinct advantages for expressing TGEV M protein in vaccine applications, and selection should be based on specific research or clinical objectives. Porcine adenovirus serotype 5 (PAdV-5) has demonstrated particular promise with several advantages: (1) Natural tropism for porcine tissues, especially the gastrointestinal tract, making it ideal for oral vaccine delivery; (2) Capacity to accommodate large inserts (up to 109.6% of wild-type genome size has been reported), allowing incorporation of full-length genes or multiple antigens ; (3) Ability to induce both systemic and mucosal immunity, with documented production of virus-neutralizing antibodies and secretory IgA following oral administration ; and (4) Safety profile with no clinical signs observed in vaccinated animals. Alternative vectors such as modified TGEV itself have also shown promise, as demonstrated by the engineered attenuated rTGEV-RS-SPEDV virus that maintained immunogenicity while showing reduced pathogenicity in piglets . When comparing vectors, researchers should consider factors including insert capacity, tissue tropism, safety profile, stability, ease of production, and the specific immune responses (type, magnitude, and duration) induced by each platform.

What are the unresolved questions regarding TGEV M protein structure-function relationships?

Despite significant advances in our understanding of TGEV M protein, several critical structure-function relationships remain unresolved. Key outstanding questions include: (1) The precise molecular mechanism by which M protein glycosylation affects virus assembly and infectivity; (2) The three-dimensional structure of the M protein, particularly in its membrane-embedded conformation; (3) The specific interactions between M protein and other viral components, especially the nucleocapsid (N) protein, during virion assembly; and (4) The potential roles of M protein in modulating host cell responses beyond its structural functions. Mass spectrometry data has provided valuable insights into the primary structure and post-translational modifications of M protein , but higher-resolution structural information through techniques such as cryo-electron microscopy will be necessary to fully elucidate its functional architecture. Addressing these questions will require interdisciplinary approaches combining structural biology, molecular virology, and immunology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.