Recombinant Porcine transmissible gastroenteritis coronavirus Non-structural protein 3b (3b)

Shipped with Ice Packs
In Stock

Description

Introduction

Porcine transmissible gastroenteritis coronavirus (TGEV) is an enteric pathogen that causes significant economic losses in the swine industry . Within the TGEV genome, open reading frame 3b (ORF3b) encodes a non-structural protein, 3b, which has been a subject of interest due to its potential role in viral pathogenesis and virulence . The precise function of protein 3b and its contribution to the TGEV life cycle are still being investigated .

Role in Pathogenesis and Virulence

The role of nonstructural proteins 3a and 3b has been implicated in determining the virulence of swine enteric and respiratory coronaviruses . Studies with infectious clones of TGEV with ORF3 gene deletions have shown slightly reduced pathogenicity in vivo, but normal replication in cell culture . In TGEV Purdue strains, a mutation in the core sequence preceding the ORF3b gene may affect the transcription of the mRNA encoding protein 3b, but protein 3b is unlikely to play a role in the attenuation of TGEV Purdue strains .

TGEV and Host Cell Interaction

TGEV strain HQ2016 replicates and exhibits pathogenicity in enterocytes and is a natural, transmissible, enteric pathogenic porcine coronavirus . TGEV infects the small intestinal epithelial cells, replicates, and causes pathological changes . The necrotic epithelial cells then release the virus into the intestinal contents, which are finally excreted through the large intestines . TGEV infection up-regulates FcRn expression via TLR3, TLR9, and RIG-I and induces the production of IL-1β, IL-6, IL-8, TGF-β, and TNF-α .

Potential Drug Targets

Two compounds, 3-(aminocarbonyl)-1-phenylpyridinium and 2,3-dichloronaphthoquinone, have been identified as potential inhibitors of the 3C-like protease (3CLpro) of porcine epidemic diarrhea virus (PEDV), another swine coronavirus . These compounds inhibit the activity of 3CLpro and exhibit antiviral capacity against feline infectious peritonitis virus (FIPV) . The conserved active sites of 3CLpro in multiple coronaviruses, including TGEV, suggest that these compounds may have antiviral activity against a broad spectrum of coronaviruses .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
3b; Non-structural protein 3b; ns3b; Accessory protein 3b; Non-structural protein 3-1; X2b protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Porcine transmissible gastroenteritis coronavirus (strain FS772/70) (TGEV)
Target Names
3b
Target Protein Sequence
MIGGLFLNTLSFVIVSNHSIVNNTANVHHIQQERVIVQQHQVVSAITQNYYPEFSIAVLF VSFLALYRSTNFKTCVGILMFKILSMTLLGPMLIAYGYYIDGIVTTTVLSLRFAYLAYFW YVNSRFEFILYNTTTLMFVHGRAAPFKRSSHSSIYVTLYGGINYMFVNDLTLHFVDPMLV SIAIRGLAHADLTVVRAVELLNGDFIYVFSQEPVVGVYNAAFSQAVLNEIDLKEEEGDRT YDVS
Uniprot No.

Target Background

Protein Families
Coronaviruses NS3b protein family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and size of the TGEV 3b protein?

The TGEV 3b protein is a polypeptide with a molecular mass of 27.7 kDa in its unmodified form. During synthesis in vitro in the presence of microsomes, it becomes an integral membrane protein, retaining its hydrophobic N-terminal signal sequence. It undergoes glycosylation on apparently two asparagine linkage sites to attain a final molecular mass of 31 kDa. Additionally, a 20-kDa N-terminally truncated, nonglycosylated, nonanchored form of the protein can also be produced via an unknown mechanism . This dual manifestation suggests a complex post-translational processing system that may be relevant to the protein's biological function.

Is the 3b protein a structural component of the TGEV virion?

No, the 3b protein does not appear to be a structural component of the TGEV virion. Research using gradient-purified Purdue TGEV and Western blotting procedures that would have detected as few as 4 molecules per virion found no evidence of gene 3b product in the virion structure . This finding indicates that the protein likely serves non-structural functions in the viral lifecycle, potentially related to host-pathogen interactions or viral replication processes within infected cells rather than being incorporated into the mature virus particle.

How do the different forms of TGEV 3b protein localize within infected cells?

Immunofluorescence patterns reveal both a punctuated perinuclear and diffuse intracytoplasmic distribution of the TGEV 3b protein . This dual localization pattern supports the existence of both transmembrane and soluble forms of the gene 3 product in the cell. The membrane-bound form (31 kDa) likely associates with cellular membranes through its retained N-terminal signal sequence, while the 20-kDa truncated, nonglycosylated form appears to be distributed throughout the cytoplasm. This differential localization may indicate distinct functional roles for each protein form in the viral lifecycle or host cell manipulation.

What expression systems are effective for producing recombinant TGEV 3b protein?

For in vitro studies of TGEV 3b protein, several expression approaches have proven effective. The gene can be cloned and expressed in vitro using transcription-translation systems supplemented with microsomes to study post-translational modifications like glycosylation and membrane integration . For cellular studies, plasmid-based expression in mammalian cell lines such as ST (swine testicular) cells has been successful. When propagating the virus itself, ST cells can be used with PRCV medium (EMEM supplemented with 0.02% yeast extract, 10% TPB, 2 mM L-glutamine, and antibiotics) . For studying specific protein interactions, tagged versions of the protein (such as FLAG-tagged constructs) have been successfully employed in immunoprecipitation and co-localization studies, similar to approaches used for other viral proteins like FMDV 3B .

How can researchers effectively detect and distinguish between different forms of TGEV 3b protein?

To detect and distinguish between the different forms of TGEV 3b protein (membrane-bound 31 kDa glycosylated form and soluble 20 kDa non-glycosylated form), researchers can employ several complementary techniques. Western blotting using antibodies against the 3b protein can distinguish the forms based on molecular weight differences. Immunofluorescence microscopy can reveal the dual localization patterns of the protein . To specifically study glycosylation, enzymatic treatments with glycosidases followed by electrophoretic mobility shift analysis can confirm modification sites. For membrane association studies, subcellular fractionation techniques combined with Western blotting can separate and identify the membrane-bound versus soluble forms. Recombinant expression systems with mutated glycosylation sites can also help elucidate the importance of these modifications.

What animal models are suitable for studying TGEV and 3b protein function in vivo?

Pigs represent the natural host and most relevant animal model for studying TGEV and its 3b protein. Research protocols typically involve oral inoculation of piglets with specific virus strains. For example, five-day-old piglets have been used as highly sensitive models for testing attenuated TGEV strains, with daily monitoring for signs of enteric disease and body weight measurements . Tissue sampling typically includes sections of jejunum (front, mid, and end) for virus titration, RNA extraction, and histopathology . For comprehensive studies, collection protocols might include fecal swabs, serum samples, and saliva samples at defined intervals post-infection. Additionally, comparative studies between natural TGEV infections and related coronaviruses like PRCV provide valuable insights into the role of gene 3b in tissue tropism and virulence .

What molecular approaches can be used to study TGEV 3b protein interactions with host factors?

Several molecular approaches can be employed to investigate TGEV 3b protein interactions with host cellular factors. Techniques include:

  • Co-immunoprecipitation (Co-IP) assays to identify protein-protein interactions, similar to those used to show FMDV 3B interaction with RIG-I

  • Yeast two-hybrid screening to identify potential binding partners

  • Proximity ligation assays for in situ detection of protein interactions

  • Mass spectrometry-based proteomics of immunoprecipitated complexes

  • Reporter gene assays to assess functional outcomes of interactions (such as ISRE luciferase reporter systems)

  • RNA immunoprecipitation (RIP) to identify potential RNA-protein interactions

  • CRISPR-Cas9 knockout/knockdown systems to validate functional significance of identified interacting partners

These approaches would help elucidate whether TGEV 3b, like some other viral proteins, interacts with host immune factors or cellular machinery to facilitate viral replication or immune evasion.

How can reverse genetics systems be utilized to study 3b protein function?

Reverse genetics systems provide powerful tools for studying TGEV 3b protein function through targeted genetic manipulation. The first coronavirus infectious cDNA clone was engineered for TGEV as a bacterial artificial chromosome (BAC) , enabling specific modifications to viral genes. Researchers can use this system to:

  • Generate 3b gene knockouts or mutants to assess the protein's role in viral replication and pathogenesis

  • Create recombinant chimeric viruses that express modified versions of 3b to investigate structure-function relationships

  • Introduce reporter genes linked to 3b expression to monitor protein production and localization in real-time

  • Engineer viruses with tagged 3b proteins for easier detection and purification

  • Create point mutations at glycosylation sites to assess the importance of post-translational modifications

Such genetic manipulations, combined with in vitro and in vivo infection models, can systematically elucidate the functions of 3b protein in the viral lifecycle and host-pathogen interactions.

What immunomodulatory functions might TGEV 3b protein possess?

While direct evidence for TGEV 3b protein's immunomodulatory functions remains limited, parallels with other viral non-structural proteins suggest potential roles. Research on FMDV 3B protein demonstrates its ability to interact with pattern recognition receptors like RIG-I, blocking TRIM25-mediated ubiquitination and subsequent activation, thereby suppressing type I interferon production and proinflammatory cytokine expression . Future research should investigate whether TGEV 3b similarly interacts with components of the innate immune system. Specifically, studies could examine if 3b affects interferon production pathways, NF-κB signaling, or expression of cytokines such as TNF-α, IL-6, and IL-1β in infected cells. Reporter assays measuring the activation of interferon-stimulated response elements (ISRE) or NF-κB promoters in the presence of 3b protein would provide valuable insights into potential immunomodulatory functions.

How might artificial intelligence and computational biology advance TGEV 3b protein research?

Artificial intelligence and computational biology approaches offer promising avenues for advancing TGEV 3b protein research:

  • Structural prediction: Using AI-powered tools like AlphaFold to predict 3b protein structure, especially for the membrane-bound versus soluble forms

  • Protein-protein interaction prediction: Computational models to identify potential host cell binding partners

  • Epitope mapping: Predicting antigenic regions for antibody development and vaccine design

  • Molecular dynamics simulations: Understanding how 3b protein interacts with cellular membranes

  • Systems biology approaches: Modeling the impact of 3b on cellular pathways

  • Comparative genomics: Analyzing 3b gene conservation and variation across multiple TGEV isolates

  • Machine learning classification of virus strains based on 3b gene sequences and correlation with virulence

These computational approaches could generate testable hypotheses and guide experimental design, potentially accelerating discoveries about 3b protein function and applications.

What is the potential of TGEV 3b protein research for vaccine development?

Research on TGEV 3b protein has significant implications for coronavirus vaccine development strategies. Since the protein appears to be non-essential for basic viral replication but may contribute to virulence , modified viruses with alterations in the 3b gene region could represent promising live attenuated vaccine candidates. The engineering of genetically defined live attenuated vaccines based on the TGEV genome has already shown promise, as demonstrated by recombinant chimeric viruses expressing PEDV spike protein that remained attenuated in piglets . Understanding the role of 3b in pathogenesis and host immune responses could inform rational vaccine design strategies, potentially leading to vaccines that maintain immunogenicity while reducing virulence. Furthermore, if 3b proves to have immunomodulatory functions, vaccines could be designed to counteract these effects, potentially enhancing immune responses to vaccination.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.