Recombinant Porcine transmissible gastroenteritis coronavirus Putative non-structural protein 3b (3b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
3b; Putative non-structural protein 3b; ns3b; Accessory protein 3b; Non-structural protein 3-1; X2b protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Porcine transmissible gastroenteritis coronavirus (strain Purdue) (TGEV)
Target Names
3b
Target Protein Sequence
MIGGLFLSTLSFVIVSNHSIVNNTANVHHIQQERVIVQQHQVVSARTQNYYPEFSIAVLF VSFLALYRSTNFKTCVGILMFKILSMTLLGPMLIAYGYYIDGIVTTTVLSLRFVYLAYFW YVNSRFEFILYNTTTLMFVHGRAAPFMRSSHSSIYVTLYGGINYMFVNDLTLHFVDPMLV SIAIRGLAHADLTVVRAVELLNGDFIYVFSQEPVVGVYNAAFSQAVLNEIDLKEEEEDHT YDVS
Uniprot No.

Target Background

Protein Families
Coronaviruses NS3b protein family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the TGEV 3b protein and what is its fundamental molecular structure?

The TGEV 3b protein (ORF 3b) is a putative nonstructural polypeptide with a molecular weight of approximately 27.7 kDa. During in vitro translation, it can become a glycosylated integral membrane protein of 31 kDa . The protein is encoded by gene 3b, which varies in length across different TGEV strains. In most strains, the 3b protein is 244 amino acids in length, though significant variations exist . The protein's structure has not been fully resolved through crystallography or cryo-EM techniques, though sequence analysis suggests it contains transmembrane domains consistent with its ability to become an integral membrane protein during in vitro studies .

The 3b protein's primary sequence is highly conserved among TGEV strains with some notable exceptions. For instance, the Miller M60 strain contains a 531 nucleotide deletion in the ORF 3b gene, resulting in a significantly truncated 3b protein of only 67 amino acids . This truncation likely affects the protein's function and may contribute to strain-specific pathogenicity profiles observed in experimental infections.

How does the genomic location of ORF 3b differ between TGEV strains?

The genomic organization of ORF 3b shows notable variations across different TGEV strains, which may impact its expression and function. This variability represents an important consideration for research design and interpretation. The position and context of ORF 3b in the viral genome differs in the following ways:

TGEV StrainmRNA ArrangementORF 3b PositionTranslation Mechanism
Miller (virulent)Produces mRNA 3-15'-terminal on mRNA 3-15' cap-dependent entry
British FS772/70 (virulent)No mRNA 3-1Second ORF on mRNA 3Internal ribosomal entry
Taiwanese TFI (virulent)No mRNA 3-1Second ORF on mRNA 3Internal ribosomal entry
Purdue-116 (avirulent)No mRNA 3-1Second ORF on mRNA 3Internal ribosomal entry

In the virulent Miller strain, ORF 3b is positioned as the 5'-terminal ORF on mRNA 3-1, allowing for cap-dependent ribosomal entry and translation . In contrast, three other strains (virulent British FS772/70, Taiwanese TFI, and avirulent Purdue-116) do not produce mRNA 3-1, and ORF 3b exists as a non-overlapping second ORF on mRNA 3 . In the Purdue strain specifically, ORF 3b begins at base 432 on mRNA 3 . These genomic differences likely influence translation efficiency and may have evolved to regulate 3b protein expression levels across different viral lineages.

What unique translation mechanisms are involved in TGEV 3b protein synthesis?

The translation of TGEV 3b protein involves unusual ribosomal entry mechanisms that differ from the canonical translation process. Experimental evidence suggests that ribosomal entry for ORF 3b translation occurs through an internal mechanism rather than the typical leaky scanning pattern . This was demonstrated through in vitro expression studies using Purdue strain mRNA 3-like transcripts, where translation patterns did not fully conform to predictions based on leaky scanning alone .

When researchers modified mRNA 3-like transcripts to carry large ORFs upstream of ORF 3a, they observed that ribosomes could still reach ORF 3b by entering at a distant downstream site . This mechanism resembles ribosomal shunting, where ribosomes bypass sections of the mRNA to initiate translation at a downstream site . Interestingly, deletion analysis failed to identify a conventional internal ribosomal entry structure (IRES) within ORF 3a, suggesting a novel or atypical mechanism at work .

The translation of ORF 3b appears to be influenced by mRNA capping, as demonstrated in studies with capped and uncapped synthetic transcripts . This combination of features suggests that ORF 3b expression likely involves multiple translation mechanisms working in concert, potentially providing the virus with translational flexibility across different cellular environments.

How does the ribosomal shunting mechanism for 3b protein differ from IRES-dependent translation?

The shunting-like mechanism observed for 3b protein translation involves ribosomes entering at a distant downstream site, effectively "jumping" over portions of the mRNA sequence . This was demonstrated experimentally with mRNA 3-like transcripts modified to carry large ORFs upstream of ORF 3a, where researchers observed continued translation of ORF 3b despite modifications that would have blocked traditional scanning mechanisms .

The unique aspects of this mechanism include:

  • Dependency on mRNA capping, with translation efficiency influenced by the presence of a 5' cap structure

  • Absence of identifiable IRES-like RNA structures in deletion analysis

  • Ability to initiate translation despite the presence of upstream ORFs

  • Potential for expression from multiple viral mRNAs (including mRNAs 1 and 2)

This distinctive translation mechanism may represent an evolutionary adaptation allowing for regulated expression of the 3b protein across different cellular conditions and viral life cycle stages.

What structural variations exist in the 3b protein across different TGEV strains and related coronaviruses?

Significant structural variations exist in the 3b protein across different TGEV strains and related coronaviruses, potentially contributing to differences in viral pathogenicity and host adaptation. Comparative genomic analyses reveal several key variations:

Virus/StrainORF 3b LengthStructural FeaturesNotable Mutations
TGEV TS strain244 aaFull-length proteinNo deletions/insertions compared to most TGEV strains
TGEV Miller M6067 aaSeverely truncated531 nt deletion in ORF 3b
PRCV ISU-1ShortenedTruncated protein117 nt deletion in ORF 3b gene
Other TGEV strains244 aaFull-length proteinMinor amino acid substitutions

The porcine respiratory coronavirus (PRCV) ISU-1, a related coronavirus, exhibits a 117 nucleotide deletion in the ORF 3b gene compared to TGEV strains, resulting in a shorter nonstructural protein . Additionally, PRCV ISU-1 has a 184 nucleotide deletion in the ORF 3a gene that disrupts the predicted open reading frame of its encoded protein, potentially affecting the translation mechanism for downstream ORF 3b .

These structural variations represent important considerations for researchers studying the 3b protein, as experimental findings may be strain-specific and not necessarily applicable across all coronavirus variants.

How might 3b protein variations correlate with TGEV pathogenicity?

The correlation between 3b protein variations and TGEV pathogenicity presents a complex research question with implications for understanding coronavirus virulence mechanisms. While direct causation remains challenging to establish, several lines of evidence suggest potential linkages between 3b protein structure and viral pathogenicity:

  • The virulent Miller strain produces a unique mRNA 3-1 with ORF 3b as the 5'-terminal gene, potentially allowing more efficient 3b protein expression through cap-dependent translation . This arrangement is not found in the avirulent Purdue-116 strain.

  • The avirulent Purdue-116 strain relies on an internal ribosomal entry mechanism for 3b protein translation, which may result in different expression levels compared to the virulent Miller strain's cap-dependent mechanism .

  • Significant deletions in ORF 3b, such as the 531 nt deletion in Miller M60 resulting in a truncated 67 aa protein, may alter protein function and potentially impact virulence .

  • The related PRCV, which has reduced virulence compared to TGEV, contains a 117 nt deletion in the ORF 3b gene, producing a shortened protein that may have altered functionality .

What experimental approaches are effective for studying the translation mechanisms of TGEV 3b protein?

Investigating the unique translation mechanisms of TGEV 3b protein requires sophisticated experimental approaches that can distinguish between different ribosomal entry pathways. Based on successful research strategies documented in the literature, the following methodological approaches are particularly effective:

  • In vitro translation systems: Cell-free translation systems using rabbit reticulocyte lysate have been effectively employed to study ORF 3b translation from synthetic transcripts . This approach allows for controlled manipulation of mRNA features and direct observation of translation products.

  • Reporter gene constructs: Creating fusion constructs with reporter genes (such as luciferase or GFP) downstream of modified TGEV genomic regions enables quantitative assessment of translation efficiency under various conditions .

  • Transcript modifications: Systematic modifications to mRNA 3-like transcripts, including:

    • Manipulating the Kozak context of upstream ORFs

    • Inserting large ORFs upstream of ORF 3a

    • Creating deletion variants to test for IRES-like elements

    • Comparing capped versus uncapped transcripts

  • RNA integrity verification: Northern blot analysis with gene-specific probes (such as probes for genes 3a or 3b) to confirm the integrity of RNA templates and rule out translation from fragmented templates .

  • Quantitative analysis: Using radioactive labeling and specialized scanning (like AMBIS scanning) to quantify translation products and compare expression levels across different constructs .

One particularly informative experimental design involved creating mRNA 3-like transcripts modified to carry large ORFs upstream of ORF 3a, which demonstrated that ribosomes could reach ORF 3b by entering at a distant downstream site in a manner resembling ribosomal shunting . This approach effectively distinguished the internal entry mechanism from traditional leaky scanning.

What molecular tools are necessary for expression and purification of recombinant 3b protein?

The expression and purification of recombinant TGEV 3b protein requires specialized molecular tools and techniques that address the challenges associated with membrane protein production. Based on established protocols for similar viral proteins, the following approach is recommended:

  • Expression Vector Selection:

    • Baculovirus expression systems using Trichoplusia ni cells have proven effective for the expression of coronavirus proteins with multiple domains

    • Mammalian expression systems may better preserve post-translational modifications like glycosylation that occur in the native 3b protein (31 kDa glycosylated form)

  • Construct Design:

    • Inclusion of a C-terminal tag (such as His6, FLAG, or Fc chimera) to facilitate purification while minimizing interference with protein folding

    • Optional inclusion of cleavable signal peptides to enhance membrane protein targeting

    • Site-directed mutagenesis to remove problematic regions (similar to the R551A, R554A mutations used in other recombinant coronavirus proteins)

  • Expression Optimization:

    • Temperature adjustment (typically 27-30°C for membrane proteins)

    • Induction parameters optimization (timing, concentration)

    • Consideration of transcriptional regulators that enhance membrane protein expression

  • Purification Strategy:

    • Detergent screening to identify optimal solubilization conditions (common options include DDM, LDAO, or Triton X-100)

    • Two-step purification using affinity chromatography followed by size exclusion chromatography

    • Buffer optimization to maintain protein stability and prevent aggregation

  • Quality Assessment:

    • SDS-PAGE and Western blotting to confirm protein identity and purity

    • Mass spectrometry to verify protein mass and detect post-translational modifications

    • Circular dichroism to assess secondary structure integrity

The glycosylated nature of the 3b protein during in vitro translation (31 kDa compared to the 27.7 kDa unmodified form) suggests that expression systems supporting proper post-translational modifications will be critical for obtaining functionally relevant recombinant protein. Additionally, the putative membrane-associated characteristics of the protein necessitate careful consideration of solubilization and stabilization conditions throughout the purification process.

How might the internal ribosomal entry mechanism for 3b expression impact viral evolution and host adaptation?

The internal ribosomal entry mechanism utilized for TGEV 3b protein expression represents a sophisticated translational strategy with significant implications for viral evolution and host adaptation. This unusual mechanism may confer several evolutionary advantages:

  • Translational flexibility in diverse cellular environments: The ability to use multiple ribosomal entry mechanisms (both cap-dependent in some strains and internal entry in others) could allow the virus to maintain 3b expression across different cellular conditions and host types . This flexibility may contribute to TGEV's ability to adapt to various porcine tissues and cell types.

  • Expanded expression potential across the viral transcriptome: The internal entry mechanism theoretically enables 3b expression not only from mRNA 3 but potentially from mRNAs 1 and 2 as well . This expanded expression potential provides the virus with redundant pathways for protein production, reducing vulnerability to host translational control mechanisms.

  • Enhanced resistance to host translational suppression: During viral infection, host cells often activate defenses that suppress cap-dependent translation. Internal ribosomal entry mechanisms may allow TGEV to bypass these defenses, maintaining 3b expression even when host translation is compromised .

  • Evolutionary plasticity: The existence of both cap-dependent and internal entry mechanisms across different TGEV strains demonstrates evolutionary plasticity in viral translation strategies . This diversity may have arisen through selective pressures in different host environments or tissue types.

The persistence of this complex translational mechanism across TGEV evolution suggests it provides significant adaptive advantages. The mechanism's resemblance to ribosomal shunting rather than conventional IRES-dependent translation further highlights the virus's capacity for novel translational innovations . Understanding these mechanisms more completely could provide insights into TGEV's evolutionary history and potential future adaptations.

What computational approaches can predict functional domains and interaction partners of the 3b protein?

Advanced computational approaches offer valuable tools for predicting functional domains and potential interaction partners of the TGEV 3b protein, providing guidance for experimental validation. Recommended computational strategies include:

  • Structural prediction pipelines:

    • AlphaFold2 or RoseTTAFold for ab initio 3D structure prediction

    • SWISS-MODEL or I-TASSER for homology-based modeling

    • Transmembrane topology prediction using TMHMM or Phobius, particularly relevant given the 3b protein's capacity to become a glycosylated integral membrane protein

  • Functional domain analysis:

    • InterProScan for identifying conserved functional domains and motifs

    • SMART (Simple Modular Architecture Research Tool) for domain architecture analysis

    • SignalP for signal peptide prediction and TargetP for subcellular localization prediction

    • Analysis of secondary structures similar to the five stem-loops (I-V) identified in TGEV gene 3a region

  • Protein-protein interaction prediction:

    • STRING database integration to identify potential interaction partners based on co-expression, experimental data, and text mining

    • PIPE (Protein-protein Interaction Prediction Engine) for sequence-based interaction prediction

    • Molecular docking simulations using tools like HADDOCK or ClusPro to evaluate potential binding interfaces with predicted partners

  • Evolutionary analysis tools:

    • PAML (Phylogenetic Analysis by Maximum Likelihood) for detecting selection signatures across the 3b protein sequence

    • Comparative genomics approaches analyzing the 3b genes across different coronaviruses, including the notable variations observed in TGEV strains and PRCV

    • Coevolution analysis to identify regions that may coevolve with interaction partners

A recommended workflow would begin with transmembrane topology prediction (critical given the 3b protein's membrane association), followed by structural modeling of discrete domains, and culminating in interaction predictions based on the modeled structures. The analysis should account for the significant variations observed across TGEV strains, particularly the truncated 3b protein (67 aa) in Miller M60 compared to the full-length protein (244 aa) in most strains .

What key knowledge gaps remain in our understanding of TGEV 3b protein function?

Despite significant advances in understanding the TGEV 3b protein's translation mechanisms, several critical knowledge gaps remain that warrant focused research efforts:

  • Definitive functional characterization: The fundamental biological function of the 3b protein remains unknown . While described as a "putative nonstructural polypeptide," its precise role in viral replication, pathogenesis, or immune evasion has not been definitively established.

  • Structure-function relationships: The three-dimensional structure of the 3b protein has not been experimentally determined, limiting our understanding of how its structure relates to function. This is particularly important given the significant variations in 3b protein length across different TGEV strains (244 aa in most strains versus 67 aa in Miller M60) .

  • Interaction network identification: The cellular and viral proteins that interact with the 3b protein remain largely uncharacterized. Identifying these interaction partners would provide valuable insights into the protein's functional role in viral replication and pathogenesis.

  • Mechanism of membrane association: While the 3b protein can become a glycosylated integral membrane protein during in vitro translation , the specific mechanisms governing its membrane association and trafficking in infected cells have not been fully elucidated.

  • Contribution to virulence: The correlation between 3b protein variations and viral pathogenicity requires further investigation. While differences exist between virulent and avirulent strains in terms of 3b expression mechanisms , direct evidence linking these differences to pathogenicity is limited.

  • Precise molecular details of internal ribosomal entry: Though evidence suggests an internal entry mechanism resembling ribosomal shunting , the precise molecular details of this process, including potential RNA structures or sequence elements that facilitate shunting, remain to be fully characterized.

Addressing these knowledge gaps would significantly advance our understanding of coronavirus biology and potentially inform strategies for controlling TGEV and related coronaviruses of agricultural or public health importance.

How can CRISPR-Cas9 and reverse genetics systems advance our understanding of 3b protein function?

CRISPR-Cas9 technology and coronavirus reverse genetics systems offer powerful platforms for interrogating TGEV 3b protein function with unprecedented precision. These advanced molecular tools enable several innovative research approaches:

  • Precise genome editing in infectious clones:

    • Generation of isogenic viral mutants with specific modifications to the 3b gene, enabling direct assessment of 3b's contribution to viral replication and pathogenesis

    • Introduction of reporter tags (such as fluorescent proteins or epitope tags) to track 3b protein localization and interactions in real-time during infection

    • Creation of 3b knockout viruses to determine whether the protein is essential for viral replication in different cell types and tissues

  • Targeted modifications of translational regulatory elements:

    • Precise alteration of putative ribosomal shunting elements to dissect the molecular mechanisms of internal ribosomal entry

    • Modification of the genomic context surrounding ORF 3b to investigate how positional effects influence translation efficiency

    • Engineering of viruses that express 3b proteins from different TGEV strains to assess functional differences in a common genetic background

  • Host cell engineering:

    • CRISPR-mediated knockout of candidate 3b interaction partners to identify essential host factors

    • Generation of reporter cell lines that allow real-time monitoring of 3b-dependent cellular processes

    • Creation of porcine cell lines or animals with modified translational machinery to probe the dependence of 3b expression on specific translation factors

  • High-throughput functional screening:

    • CRISPR-based screens to identify host factors that influence 3b protein expression, localization, or function

    • Systematic mutagenesis of the 3b protein to create a comprehensive map of functional domains and critical residues

These approaches offer significant advantages over traditional methods, including the ability to study 3b protein function in the context of authentic viral infection rather than relying solely on overexpression systems. Additionally, the precise control afforded by CRISPR-Cas9 enables investigation of subtle regulatory mechanisms that might be missed by conventional genetic approaches.

Implementation of these technologies could resolve longstanding questions about the 3b protein's role in viral pathogenesis and potentially reveal new targets for intervention against TGEV and related coronaviruses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.