Recombinant Porphyromonas gingivalis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; PGN_1119; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Target Names
mscL
Target Protein Sequence
MKKFIQDFKAFALKGNVVDMAVGVIIGGAFGKIVTSLVNDIMMPPISLLTGGVNFTDLKL VLSKAVVEGGEVVKPEVSWNYGNFIQTTVDFLILAFVIFLMIKAIMAAKRKEEEAPAAPA PTPPEIELLTEIRDLLKKQ
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It may play a regulatory role in cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Methodological Questions

  • What expression systems are optimal for producing functional recombinant P. gingivalis mscL?

    E. coli expression systems with N-terminal His-tags have been successfully used to produce recombinant P. gingivalis mscL . The methodology involves:

    • Cloning the mscL gene (PGN_1119) into appropriate expression vectors

    • Transformation into competent E. coli cells

    • Induction of protein expression (typically with IPTG)

    • Cell lysis and protein extraction

    • Purification via metal affinity chromatography utilizing the His-tag

    For membrane proteins like mscL, consider these methodological considerations:

    1. Use of detergents during purification to maintain protein solubility

    2. Optimization of induction conditions (temperature, duration, inducer concentration)

    3. Selection of appropriate E. coli strains (e.g., C41(DE3) or C43(DE3)) specialized for membrane protein expression

    4. Potential use of fusion partners to enhance solubility

  • How should recombinant P. gingivalis mscL be properly stored and handled to maintain functionality?

    Based on established protocols for recombinant P. gingivalis proteins, optimal storage conditions include :

    • Store lyophilized protein at -20°C/-80°C

    • For reconstituted protein, add 5-50% glycerol (final concentration) as a cryoprotectant

    • Aliquot to avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Use Tris/PBS-based buffer with 6% trehalose at pH 8.0 for storage

    For experiments requiring functional channels, consider incorporating the protein into artificial lipid bilayers or liposomes to maintain native conformation.

  • What analytical methods are recommended for assessing the structural integrity and functionality of recombinant P. gingivalis mscL?

    Multiple complementary techniques should be employed:

    1. Structural Analysis:

      • SDS-PAGE to confirm protein purity and molecular weight (approximately 15-16 kDa for the monomer)

      • Size exclusion chromatography to verify oligomeric state (likely tetrameric based on studies of related bacterial mscL proteins)

      • Circular dichroism spectroscopy to analyze secondary structure content

    2. Functional Assessment:

      • Patch-clamp electrophysiology for channel conductance measurements

      • Fluorescence-based liposome assays to evaluate channel activity in response to membrane tension

      • Osmotic shock survival assays in mscL-deficient bacterial strains complemented with P. gingivalis mscL

    3. Interaction Studies:

      • Surface plasmon resonance to investigate potential interactions with other membrane components

      • Cross-linking experiments to validate oligomeric assembly

Research Methodology Considerations

  • What purification challenges are specific to recombinant P. gingivalis mscL and how can they be addressed?

    Purifying membrane proteins like mscL presents several technical challenges:

    1. Membrane Extraction: Effective solubilization requires careful detergent selection. Consider a panel approach testing:

      • Mild detergents (DDM, LMNG)

      • Zwitterionic detergents (CHAPS, LDAO)

      • Novel amphipols or nanodiscs for maintaining native conformation

    2. Protein Stability: P. gingivalis proteins may exhibit instability during purification, as observed with gingipains that undergo self-digestion . Implement:

      • Addition of protease inhibitors during purification

      • Maintaining samples at 4°C throughout the procedure

      • Consideration of site-directed mutagenesis of unstable regions (similar to the cysteine-to-alanine substitutions used to stabilize gingipains)

    3. Oligomeric State Preservation: Evidence from related bacterial proteins suggests mscL forms tetramers that are crucial for function . Validate oligomeric state using:

      • Blue native PAGE

      • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

      • Analytical ultracentrifugation

    4. Yield Optimization: To improve recovery of functional protein:

      • Screen multiple E. coli expression strains

      • Test induction at lower temperatures (16-18°C)

      • Consider codon optimization for P. gingivalis genes expressed in E. coli

  • How can researchers effectively evaluate the immunogenicity of recombinant P. gingivalis mscL?

    Systematic immunological assessment should include:

    1. Serum Antibody Response Analysis:

      • Multiplex bead-based assays to quantify IgG antibodies against the recombinant protein

      • ELISA to measure antibody titers in human or animal samples

      • Western blot analysis to confirm antibody specificity

    2. T Cell Response Evaluation:

      • ELISpot assays to detect antigen-specific T cell activation

      • Flow cytometry to characterize T cell subsets responding to the antigen

      • Cytokine profiling to assess the type of immune response generated

    3. Comparative Immunogenicity Assessment:

      • Include well-characterized P. gingivalis antigens (FimA, gingipains) as benchmarks

      • Compare responses across different patient groups (healthy, periodontitis stages)

      • Analyze cross-reactivity with other bacterial proteins

    Research with other P. gingivalis antigens shows that serum IgG antibodies against whole bacteria provide good indicators of periodontitis (AUC: 0.75, 95% CI: 0.64-0.85) and oral carriage of the bacterium (AUC: 0.92, 95% CI: 0.86-0.98) . Similar methodologies could be applied to evaluate mscL-specific responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.